Clone BO31115 Report

Search the DGRC for BO31115

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG13069-RA
Protein status:BO31115.pep: Imported from assembly
Sequenced Size:325

Clone Sequence Records

BO31115.complete Sequence

325 bp assembled on 2012-03-19

GenBank Submission: KX794644

> BO31115.complete
GAAGTTATCAGTCGACATGTTCAAGTTCTTCGCCGTCGCCCTCTTCGCAC
TGATTGCCTGCGTGGCCGCCAAGCCCGGAATCGTGGCTCCTCTGGCCTAC
TCCGCACCTCTGGTGGCTGCTGCTCCGGCGGCTGCGGTTTACAGCCGGGA
ATACCACGGAAATTTTGCGGCTCCCTACGTGGCATCTCCCTATGTGGCTT
CTCCCTACGTGGCTTCTCCCTACGTCGCTTCCCCTTACGTGGCGTCTCCG
TATGTGGCATCTCCCTACGTTGCCGCCCCCTACACCGCTCCTCTGCTGCT
GAAGAAGGCAAGCTTTCTAGACCAT

BO31115.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-RA 294 CG13069-PA 1..291 17..307 1455 100 Plus
CG13051-RA 252 CG13051-PA 1..89 17..105 355 93.3 Plus
CG13051-RA 252 CG13051-PA 91..156 173..238 210 87.9 Plus
CG13051-RA 252 CG13051-PA 91..162 218..289 195 84.7 Plus
CG13051-RA 252 CG13051-PA 89..141 231..283 190 90.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-RA 420 CG13069-RA 46..336 17..307 1455 100 Plus
CG13051-RA 388 CG13051-RA 36..124 17..105 355 93.3 Plus
CG13051-RA 388 CG13051-RA 126..191 173..238 210 87.9 Plus
CG13051-RA 388 CG13051-RA 126..197 218..289 195 84.7 Plus
CG13051-RA 388 CG13051-RA 124..176 231..283 190 90.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16265430..16265720 17..307 1455 100 Plus
3L 28110227 3L 16264977..16265065 105..17 355 93.3 Minus
3L 28110227 3L 16264910..16264975 238..173 210 87.9 Minus
3L 28110227 3L 16264904..16264975 289..218 195 84.7 Minus
3L 28110227 3L 16264925..16264977 283..231 190 90.6 Minus
Blast to na_te.dros performed on 2014-11-28 05:22:07 has no hits.

BO31115.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:05:54 Download gff for BO31115.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 51..336 22..309 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:38:04 Download gff for BO31115.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 51..336 22..309 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:09:40 Download gff for BO31115.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 51..336 22..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:09:40 Download gff for BO31115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16265435..16265720 22..309 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:38:04 Download gff for BO31115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16258535..16258820 22..309 99   Plus

BO31115.pep Sequence

Translation from 16 to 325

> BO31115.pep
MFKFFAVALFALIACVAAKPGIVAPLAYSAPLVAAAPAAAVYSREYHGNF
AAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAPYTAPLLLKKASF
LDH

BO31115.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-PA 97 CG13069-PA 1..97 1..97 493 100 Plus
CG13051-PA 83 CG13051-PA 1..83 1..97 243 56.2 Plus
CG13067-PA 79 CG13067-PA 1..76 1..76 175 55 Plus
CG18294-PA 141 CG18294-PA 1..114 1..99 175 45 Plus
CG32214-PC 116 CG32214-PC 1..111 1..99 166 44.8 Plus