Clone BO31126 Report

Search the DGRC for BO31126

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG42524-RA
Protein status:BO31126.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO31126.complete Sequence

289 bp assembled on 2012-03-19

GenBank Submission: KX796497

> BO31126.complete
GAAGTTATCAGTCGACATGATCGAAAACGATGGTGAGAGGGAGAGGGGTG
GAGAACCGGCGATAAGGAAGTGCGGATGTCTTTGGGCTCCTGCTTGGACT
TGGAAGATGGAAATCTTAATCCAAACGAATGGAAATGGAAGTCGAGAAGC
ACAGCCCACACGCACACAAACACATACACATAGAGAAGGACTTCTTGGGA
ACCAAGGTACTTCCGGAATGGATGGCCCGACTCCTGACTCCTCCTGGTCC
TGCCAGCTGGATCCTCCGGTCGCAAGCTTTCTAGACCAT

BO31126.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42524-RB 258 CG42524-PB 1..255 17..271 1275 100 Plus
CG42524-RA 258 CG42524-PA 1..255 17..271 1275 100 Plus
CG42524-RC 258 CG42524-PC 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42524-RB 1881 CG42524-RB 1384..1643 12..271 1285 99.6 Plus
CG42524-RA 1984 CG42524-RA 1384..1643 12..271 1285 99.6 Plus
CG42524-RC 2167 CG42524-RC 1384..1643 12..271 1285 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15637758..15637884 145..271 635 100 Plus
2R 25286936 2R 15630709..15630780 75..146 360 100 Plus
2R 25286936 2R 15615237..15615300 12..75 305 98.4 Plus
Blast to na_te.dros performed on 2014-11-28 05:25:43 has no hits.

BO31126.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:05:59 Download gff for BO31126.complete
Subject Subject Range Query Range Percent Splice Strand
CG42524-RA 1141..1395 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:38:36 Download gff for BO31126.complete
Subject Subject Range Query Range Percent Splice Strand
CG42524-RC 1389..1643 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:11:00 Download gff for BO31126.complete
Subject Subject Range Query Range Percent Splice Strand
CG42524-RC 1389..1643 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:11:00 Download gff for BO31126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15637760..15637884 147..273 98   Plus
2R 15615242..15615300 17..75 100 -> Plus
2R 15630710..15630780 76..146 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:38:36 Download gff for BO31126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11502747..11502805 17..75 100 -> Plus
arm_2R 11518215..11518285 76..146 100 -> Plus
arm_2R 11525265..11525389 147..273 98   Plus

BO31126.pep Sequence

Translation from 16 to 289

> BO31126.pep
MIENDGERERGGEPAIRKCGCLWAPAWTWKMEILIQTNGNGSREAQPTRT
QTHTHREGLLGNQGTSGMDGPTPDSSWSCQLDPPVASFLDH

BO31126.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42524-PB 85 CG42524-PB 1..85 1..85 481 100 Plus
CG42524-PA 85 CG42524-PA 1..85 1..85 481 100 Plus
CG42524-PC 85 CG42524-PC 1..85 1..85 481 100 Plus