BO31126.complete Sequence
289 bp assembled on 2012-03-19
GenBank Submission: KX796497
> BO31126.complete
GAAGTTATCAGTCGACATGATCGAAAACGATGGTGAGAGGGAGAGGGGTG
GAGAACCGGCGATAAGGAAGTGCGGATGTCTTTGGGCTCCTGCTTGGACT
TGGAAGATGGAAATCTTAATCCAAACGAATGGAAATGGAAGTCGAGAAGC
ACAGCCCACACGCACACAAACACATACACATAGAGAAGGACTTCTTGGGA
ACCAAGGTACTTCCGGAATGGATGGCCCGACTCCTGACTCCTCCTGGTCC
TGCCAGCTGGATCCTCCGGTCGCAAGCTTTCTAGACCAT
BO31126.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:25:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42524-RB | 258 | CG42524-PB | 1..255 | 17..271 | 1275 | 100 | Plus |
CG42524-RA | 258 | CG42524-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
CG42524-RC | 258 | CG42524-PC | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42524-RB | 1881 | CG42524-RB | 1384..1643 | 12..271 | 1285 | 99.6 | Plus |
CG42524-RA | 1984 | CG42524-RA | 1384..1643 | 12..271 | 1285 | 99.6 | Plus |
CG42524-RC | 2167 | CG42524-RC | 1384..1643 | 12..271 | 1285 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 15637758..15637884 | 145..271 | 635 | 100 | Plus |
2R | 25286936 | 2R | 15630709..15630780 | 75..146 | 360 | 100 | Plus |
2R | 25286936 | 2R | 15615237..15615300 | 12..75 | 305 | 98.4 | Plus |
Blast to na_te.dros performed on 2014-11-28 05:25:43 has no hits.
BO31126.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:05:59 Download gff for
BO31126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42524-RA | 1141..1395 | 17..273 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:38:36 Download gff for
BO31126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42524-RC | 1389..1643 | 17..273 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:11:00 Download gff for
BO31126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42524-RC | 1389..1643 | 17..273 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:11:00 Download gff for
BO31126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 15637760..15637884 | 147..273 | 98 | | Plus |
2R | 15615242..15615300 | 17..75 | 100 | -> | Plus |
2R | 15630710..15630780 | 76..146 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:38:36 Download gff for
BO31126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 11502747..11502805 | 17..75 | 100 | -> | Plus |
arm_2R | 11518215..11518285 | 76..146 | 100 | -> | Plus |
arm_2R | 11525265..11525389 | 147..273 | 98 | | Plus |
BO31126.pep Sequence
Translation from 16 to 289
> BO31126.pep
MIENDGERERGGEPAIRKCGCLWAPAWTWKMEILIQTNGNGSREAQPTRT
QTHTHREGLLGNQGTSGMDGPTPDSSWSCQLDPPVASFLDH
BO31126.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:54:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42524-PB | 85 | CG42524-PB | 1..85 | 1..85 | 481 | 100 | Plus |
CG42524-PA | 85 | CG42524-PA | 1..85 | 1..85 | 481 | 100 | Plus |
CG42524-PC | 85 | CG42524-PC | 1..85 | 1..85 | 481 | 100 | Plus |