Clone BO31132 Report

Search the DGRC for BO31132

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG13064-RA
Protein status:BO31132.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO31132.complete Sequence

295 bp assembled on 2012-03-19

GenBank Submission: KX794512

> BO31132.complete
GAAGTTATCAGTCGACATGTTCAAGCTCGTCGTGCTATTCGGCCTTTTGA
GTGGTGCCTTTGCCGCCACGGTTATCTACCATCACCCGGTGATCTATCAT
CATCCTCTGCCGGTTGCATCAACGCCCCAGGAGTTGGCTCAGCATCCTGG
CTACACCATTGTGGCACCTCTCACGAAGATTGCCCACGTCACCTACGATT
CGGTGCCCATTTCGCACACGCCCTACGAACATGTTCCTCTCTTCCAGAGG
ATTGGTCATGTCAAAAACATTAGGTTCGCAAGCTTTCTAGACCAT

BO31132.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-RA 264 CG13064-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-RA 394 CG13064-RA 76..336 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16280549..16280802 24..277 1270 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:27:38 has no hits.

BO31132.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:03 Download gff for BO31132.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 6..261 22..279 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:38:58 Download gff for BO31132.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 81..336 22..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:11:43 Download gff for BO31132.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 81..336 22..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:11:43 Download gff for BO31132.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16280547..16280802 22..279 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:38:58 Download gff for BO31132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16273647..16273902 22..279 98   Plus

BO31132.pep Sequence

Translation from 16 to 295

> BO31132.pep
MFKLVVLFGLLSGAFAATVIYHHPVIYHHPLPVASTPQELAQHPGYTIVA
PLTKIAHVTYDSVPISHTPYEHVPLFQRIGHVKNIRFASFLDH

BO31132.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-PA 87 CG13064-PA 1..87 1..87 465 100 Plus