BO31138.complete Sequence
310 bp assembled on 2012-03-19
GenBank Submission: KX797828
> BO31138.complete
GAAGTTATCAGTCGACATGAAGTCCGCACTACTTTTGATCTGCCTTGCCT
TCTTCGTGGCGCTCCTAAGCACCGGAAATGCGTGCGATCCCAATTCTGAC
AACCAGCCCGACTGCAGCGACGCATCCAACGTGCAAACGAACATCCGCAA
CTTCTGGGATCCCACTCGCTACTGGTGGTGTGAGTCCTCCACCTCCACGG
CCACGGCTGTGTTGTGCCCGTTGTCCACTGGATTCGACCCCACAAAGAAG
GAGTGCGTTTCATGGAGCGAATGGTCTTGGACTGCTTACTGTGCAAGCTT
TCTAGACCAT
BO31138.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:29:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Peritrophin-15a-RA | 279 | CG17814-PA | 1..276 | 17..292 | 1380 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:29:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Peritrophin-15a-RA | 361 | CG17814-RA | 34..310 | 16..292 | 1385 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:29:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 8395716..8395982 | 292..26 | 1335 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 05:29:45 has no hits.
BO31138.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:05 Download gff for
BO31138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Peritrophin-15a-RA | 23..298 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:39:13 Download gff for
BO31138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Peritrophin-15a-RA | 35..310 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:12:24 Download gff for
BO31138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Peritrophin-15a-RA | 35..310 | 17..294 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:12:24 Download gff for
BO31138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 8395713..8395982 | 26..294 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:39:13 Download gff for
BO31138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 8395713..8395982 | 26..294 | 99 | | Minus |
BO31138.pep Sequence
Translation from 16 to 310
> BO31138.pep
MKSALLLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNFWDPT
RYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSWTAYCASFLDH
BO31138.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:54:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Peritrophin-15a-PA | 92 | CG17814-PA | 1..92 | 1..92 | 522 | 100 | Plus |
Peritrophin-15b-PC | 93 | CG31893-PC | 1..89 | 1..93 | 202 | 44.1 | Plus |
Peritrophin-15b-PA | 93 | CG31893-PA | 1..89 | 1..93 | 202 | 44.1 | Plus |
Peritrophin-15b-PB | 91 | CG31893-PB | 1..87 | 1..93 | 191 | 42.1 | Plus |
CG14645-PA | 97 | CG14645-PA | 12..85 | 16..88 | 161 | 39.2 | Plus |