Clone BO31138 Report

Search the DGRC for BO31138

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptPeritrophin-15a-RA
Protein status:BO31138.pep: Imported from assembly
Sequenced Size:310

Clone Sequence Records

BO31138.complete Sequence

310 bp assembled on 2012-03-19

GenBank Submission: KX797828

> BO31138.complete
GAAGTTATCAGTCGACATGAAGTCCGCACTACTTTTGATCTGCCTTGCCT
TCTTCGTGGCGCTCCTAAGCACCGGAAATGCGTGCGATCCCAATTCTGAC
AACCAGCCCGACTGCAGCGACGCATCCAACGTGCAAACGAACATCCGCAA
CTTCTGGGATCCCACTCGCTACTGGTGGTGTGAGTCCTCCACCTCCACGG
CCACGGCTGTGTTGTGCCCGTTGTCCACTGGATTCGACCCCACAAAGAAG
GAGTGCGTTTCATGGAGCGAATGGTCTTGGACTGCTTACTGTGCAAGCTT
TCTAGACCAT

BO31138.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-RA 279 CG17814-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-RA 361 CG17814-RA 34..310 16..292 1385 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8395716..8395982 292..26 1335 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:29:45 has no hits.

BO31138.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:05 Download gff for BO31138.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 23..298 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:39:13 Download gff for BO31138.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 35..310 17..294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:12:24 Download gff for BO31138.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 35..310 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:12:24 Download gff for BO31138.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8395713..8395982 26..294 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:39:13 Download gff for BO31138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8395713..8395982 26..294 99   Minus

BO31138.pep Sequence

Translation from 16 to 310

> BO31138.pep
MKSALLLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNFWDPT
RYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSWTAYCASFLDH

BO31138.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-PA 92 CG17814-PA 1..92 1..92 522 100 Plus
Peritrophin-15b-PC 93 CG31893-PC 1..89 1..93 202 44.1 Plus
Peritrophin-15b-PA 93 CG31893-PA 1..89 1..93 202 44.1 Plus
Peritrophin-15b-PB 91 CG31893-PB 1..87 1..93 191 42.1 Plus
CG14645-PA 97 CG14645-PA 12..85 16..88 161 39.2 Plus