Clone BO31143 Report

Search the DGRC for BO31143

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG8446-RE
Protein status:BO31143.pep: Imported from assembly
Sequenced Size:274

Clone Sequence Records

BO31143.complete Sequence

274 bp assembled on 2012-03-19

GenBank Submission: KX795304

> BO31143.complete
GAAGTTATCAGTCGACATGGTTCGACCAACACTAGTTGCGCTGGCTAAGC
GCGTACCGCTCATACACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCC
CAGACAGCAAACCAGAAGGCAAGTTCCCAGGCCGCAGGAGGCAAAAAGTT
GGCCGGTGGACCAGCAATTGAGGACTACGAGCTGCCGGCACGATTTGCCC
GCAAGCCAATTGATCCCGAAGAGGCGGCTTACATTAATAATGGGGGTATT
CCAAACGCAAGCTTTCTAGACCAT

BO31143.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RB 243 CG44242-PB 1..240 17..256 1200 100 Plus
CG44242-RA 213 CG44242-PA 100..210 146..256 555 100 Plus
CG44242-RA 213 CG44242-PA 1..102 17..118 510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RB 456 CG44242-RB 88..327 17..256 1200 100 Plus
CG44242-RA 426 CG44242-RA 187..297 146..256 555 100 Plus
CG44242-RA 426 CG44242-RA 88..189 17..118 510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16196471..16196602 17..148 660 100 Plus
2R 25286936 2R 16196690..16196799 147..256 550 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:30:27 has no hits.

BO31143.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:07 Download gff for BO31143.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RE 86..325 17..258 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:39:25 Download gff for BO31143.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 88..327 17..258 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:12:40 Download gff for BO31143.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 88..327 17..258 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:12:40 Download gff for BO31143.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196471..16196602 17..148 100 -> Plus
2R 16196692..16196799 149..258 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:39:25 Download gff for BO31143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083976..12084107 17..148 100 -> Plus
arm_2R 12084197..12084304 149..258 98   Plus

BO31143.pep Sequence

Translation from 16 to 274

> BO31143.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKASSQAAGGKKLAGGPA
IEDYELPARFARKPIDPEEAAYINNGGIPNASFLDH

BO31143.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PB 80 CG44242-PB 1..80 1..80 411 100 Plus
CG44242-PA 70 CG44242-PA 1..70 1..80 343 87.5 Plus