Clone BO31159 Report

Search the DGRC for BO31159

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:59
Vector:pDNR-Dual
Associated Gene/Transcriptdro6-RA
Protein status:BO31159.pep: Imported from assembly
Sequenced Size:250

Clone Sequence Records

BO31159.complete Sequence

250 bp assembled on 2012-03-19

GenBank Submission: KX798413

> BO31159.complete
GAAGTTATCAGTTGACATGATGCAAATCAAGTTCCTGTTCACCTTCCTCG
CTCTGCTGATGATGGTCATCCTGGGCGCCAAGGAAGCCGATGCCGACTGC
CTTTCCGGAAGGTACAGAGGTCCCTGTGCCGTCTGGGACAACGAGACATG
CAGGCGGGTTTGCCGAGAGGAGGGACGAGGACGAGTGAGTGGTCACTGCA
GTGCCAGGCTGCAATGCTGGTGCGAAGGATGCGCAAGCTTTCTAGACCAT

BO31159.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl6-RA 219 CG32268-PA 1..216 17..232 1080 100 Plus
Drsl5-RA 210 CG10812-PA 1..207 20..232 415 80.8 Plus
Drs-RA 213 CG10810-PA 1..161 17..177 400 83.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl6-RA 387 CG32268-RA 57..272 17..232 1080 100 Plus
Drsl5-RA 364 CG10812-RA 55..261 20..232 415 80.8 Plus
Drs-RA 387 CG10810-RA 64..224 17..177 400 83.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3336147..3336362 232..17 1080 100 Minus
3L 28110227 3L 3316835..3317041 20..232 415 80.8 Plus
3L 28110227 3L 3369619..3369779 17..177 400 83.2 Plus
3L 28110227 3L 3314365..3314584 7..232 300 76.5 Plus
Blast to na_te.dros performed on 2014-11-28 05:32:34 has no hits.

BO31159.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:09 Download gff for BO31159.complete
Subject Subject Range Query Range Percent Splice Strand
dro6-RA 57..272 17..234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:39:36 Download gff for BO31159.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl6-RA 57..272 17..234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:13:21 Download gff for BO31159.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl6-RA 57..272 17..234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:13:21 Download gff for BO31159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3336144..3336362 17..234 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:39:36 Download gff for BO31159.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3336144..3336362 17..234 99   Minus

BO31159.pep Sequence

Translation from 16 to 250

> BO31159.pep
MMQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVWDNETCRRVCR
EEGRGRVSGHCSARLQCWCEGCASFLDH

BO31159.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl6-PA 72 CG32268-PA 1..72 1..72 403 100 Plus
Drs-PA 70 CG10810-PA 1..70 1..72 324 77.8 Plus
Drsl5-PA 69 CG10812-PA 1..69 2..72 316 78.9 Plus
Drsl2-PA 70 CG32279-PA 1..70 1..72 299 69.4 Plus
Drsl1-PA 69 CG32274-PA 1..69 2..72 247 60.6 Plus