Clone BO31171 Report

Search the DGRC for BO31171

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG7443-RA
Protein status:BO31171.pep: Imported from assembly
Sequenced Size:451

Clone Sequence Records

BO31171.complete Sequence

451 bp assembled on 2012-03-19

GenBank Submission: KX795675

> BO31171.complete
GAAGTTATCAGTCGACATGTTTAGTTTTCTGAGCATTGAGGCTAGGTCAT
TGGAGGAAACCTCTGTCAAGACGAAACGCGATACCGACTGGTGGACTATC
CTCGAGGATATACTCTATGACAATGATAGTGATAGTGATGATGCCGGCGA
TGAGAACGTTTTGATTTGTCGTAACTGCACGGTAGTTGTTCAAGCTGCTC
CAAACGCCACAGCGAATGGAAGCACTGTAGCTCCGCAGGCAGGTGGAGCA
GCTCCAGGGAGTTCACCAGGTGCGCCTGCCACTCCTCCTGGCTCGACTCC
TGCAGTTCCAGCCACAGTTGCACCCGAAACGCCTGCTCCGTCGGCACCTG
CGACATCGCCACAACCTGTAGTAACTGCCCTACCCACAGCTGCCCCACCT
ACAGCTGCCCCACCCACAGCTGCCCCTGGTGGTGCAAGCTTTCTAGACCA
T

BO31171.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-RA 420 CG7443-PA 1..417 17..433 2085 100 Plus
CG7443-RB 396 CG7443-PB 146..393 186..433 1240 100 Plus
CG7443-RB 396 CG7443-PB 1..146 17..162 730 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-RA 616 CG7443-RA 62..478 17..433 2085 100 Plus
CG7443-RB 592 CG7443-RB 207..454 186..433 1240 100 Plus
CG7443-RB 592 CG7443-RB 62..207 17..162 730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8324627..8324898 162..433 1360 100 Plus
3R 32079331 3R 8324485..8324573 73..161 445 100 Plus
3R 32079331 3R 8324377..8324433 17..73 285 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:37:55 has no hits.

BO31171.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:15 Download gff for BO31171.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 49..459 23..435 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:40:10 Download gff for BO31171.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 68..478 23..435 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:15:13 Download gff for BO31171.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 68..478 23..435 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:15:13 Download gff for BO31171.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8324383..8324433 23..73 100 -> Plus
3R 8324486..8324573 74..161 100 -> Plus
3R 8324627..8324898 162..435 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:40:10 Download gff for BO31171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4150208..4150295 74..161 100 -> Plus
arm_3R 4150349..4150620 162..435 99   Plus
arm_3R 4150105..4150155 23..73 100 -> Plus

BO31171.pep Sequence

Translation from 16 to 451

> BO31171.pep
MFSFLSIEARSLEETSVKTKRDTDWWTILEDILYDNDSDSDDAGDENVLI
CRNCTVVVQAAPNATANGSTVAPQAGGAAPGSSPGAPATPPGSTPAVPAT
VAPETPAPSAPATSPQPVVTALPTAAPPTAAPPTAAPGGASFLDH

BO31171.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-PA 139 CG7443-PA 1..139 1..139 727 100 Plus
CG7443-PB 131 CG7443-PB 1..131 1..139 658 93.5 Plus