Clone BO31188 Report

Search the DGRC for BO31188

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG34106-RA
Protein status:BO31188.pep: Imported from assembly
Sequenced Size:400

Clone Sequence Records

BO31188.complete Sequence

400 bp assembled on 2012-03-19

GenBank Submission: KX794400

> BO31188.complete
GAAGTTATCAGTCGACATGTATGACCAGGTGATATTCACAGCTGAACTCT
TGCACCACAGAACTGTGGGCAGCCAAATCGAGGAGACACGGCGCCATTGG
GAGGAGCGGTGCTCTTGGTTTCCGGCTGCCCAAAGGAATATGGCATCAAG
GTGTTCAGAAATTTACAAGGAGAGTCTTGAAAAATACGGCAACGATTACT
ACGAGTTCTATGCCAATAGGAATCGTCTGAAGGAAGAACACAGAGTTAAT
ACCAAGTCTTATAAACGTCGGGAAAGAAGAAGGTCCCACAGGCCAATGGA
CCACTTAAAAGACTATAGGGTGTCACCAACTTCAAACGGGGAGTACGGAA
GTGTTCGGCCAATGCTTCTCCTTCAATGGCTTGCAAGCTTTCTAGACCAT

BO31188.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34106-RB 369 CG34106-PB 1..366 17..382 1830 100 Plus
CG34106-RA 369 CG34106-PA 1..366 17..382 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIIa-RE 4457 CG12621-RE 2819..3184 17..382 1830 100 Plus
CG34106-RB 4457 CG34106-RB 2819..3184 17..382 1830 100 Plus
CG34106-RA 556 CG34106-RA 69..434 17..382 1830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17171480..17171845 17..382 1830 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:03:12 has no hits.

BO31188.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:26 Download gff for BO31188.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 74..439 17..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:14 Download gff for BO31188.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 69..434 17..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:17 Download gff for BO31188.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 69..434 17..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:17 Download gff for BO31188.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17171480..17171845 17..384 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:14 Download gff for BO31188.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17171480..17171845 17..384 99   Plus

BO31188.pep Sequence

Translation from 16 to 400

> BO31188.pep
MYDQVIFTAELLHHRTVGSQIEETRRHWEERCSWFPAAQRNMASRCSEIY
KESLEKYGNDYYEFYANRNRLKEEHRVNTKSYKRRERRRSHRPMDHLKDY
RVSPTSNGEYGSVRPMLLLQWLASFLDH

BO31188.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG34106-PB 122 CG34106-PB 1..122 1..122 665 100 Plus
CG34106-PA 122 CG34106-PA 1..122 1..122 665 100 Plus
CG34169-PA 124 CG34169-PA 4..120 2..118 296 49.6 Plus
CG3611-PB 121 CG3611-PB 5..118 5..118 164 29.8 Plus
CG3611-PC 121 CG3611-PC 5..118 5..118 164 29.8 Plus