Clone BO31189 Report

Search the DGRC for BO31189

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG34180-RB
Protein status:BO31189.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO31189.complete Sequence

262 bp assembled on 2012-03-19

GenBank Submission: KX794646

> BO31189.complete
GAAGTTATCAGTCGACATGCTTTACAAATCTCTGCTGTTTTGCTTGGCGG
CGGTTTTGTTCATTCCGGCGCATTCCGATGCCAAGGAATATCAGTTCATC
CCCGCTCGATGCGAGGAGCAGCCTGGAGTGGGTCAACAGATTGGCGGTCC
CTTAAGCATATGCAGCTTTCCACCAGACTATGCGAAACCGGATTCAGAGG
ACATACAGGCCGTGATTAAACACATTAAGAGCTTGAAATTGAATGCAAGC
TTTCTAGACCAT

BO31189.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34180-RB 231 CG34180-PB 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34180-RB 376 CG34180-RB 35..262 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6060668..6060824 88..244 785 100 Plus
2L 23513712 2L 6060544..6060618 17..91 360 98.7 Plus
Blast to na_te.dros performed 2014-11-28 04:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 10324..10370 61..15 118 72.3 Minus

BO31189.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:35:18 Download gff for BO31189.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 35..262 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:46 Download gff for BO31189.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 35..262 17..246 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:45 Download gff for BO31189.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 35..262 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:45 Download gff for BO31189.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6060544..6060614 17..87 100 -> Plus
2L 6060668..6060824 88..246 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:46 Download gff for BO31189.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6060544..6060614 17..87 100 -> Plus
arm_2L 6060668..6060824 88..246 98   Plus

BO31189.pep Sequence

Translation from 16 to 262

> BO31189.pep
MLYKSLLFCLAAVLFIPAHSDAKEYQFIPARCEEQPGVGQQIGGPLSICS
FPPDYAKPDSEDIQAVIKHIKSLKLNASFLDH

BO31189.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34180-PB 76 CG34180-PB 1..76 1..76 400 100 Plus