BO31189.complete Sequence
262 bp assembled on 2012-03-19
GenBank Submission: KX794646
> BO31189.complete
GAAGTTATCAGTCGACATGCTTTACAAATCTCTGCTGTTTTGCTTGGCGG
CGGTTTTGTTCATTCCGGCGCATTCCGATGCCAAGGAATATCAGTTCATC
CCCGCTCGATGCGAGGAGCAGCCTGGAGTGGGTCAACAGATTGGCGGTCC
CTTAAGCATATGCAGCTTTCCACCAGACTATGCGAAACCGGATTCAGAGG
ACATACAGGCCGTGATTAAACACATTAAGAGCTTGAAATTGAATGCAAGC
TTTCTAGACCAT
BO31189.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:04:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34180-RB | 231 | CG34180-PB | 1..228 | 17..244 | 1140 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:04:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34180-RB | 376 | CG34180-RB | 35..262 | 17..244 | 1140 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:04:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6060668..6060824 | 88..244 | 785 | 100 | Plus |
2L | 23513712 | 2L | 6060544..6060618 | 17..91 | 360 | 98.7 | Plus |
Blast to na_te.dros performed 2014-11-28 04:04:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TART-B | 10654 | TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). | 10324..10370 | 61..15 | 118 | 72.3 | Minus |
BO31189.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:35:18 Download gff for
BO31189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34180-RB | 35..262 | 17..246 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:46 Download gff for
BO31189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34180-RB | 35..262 | 17..246 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:45 Download gff for
BO31189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34180-RB | 35..262 | 17..246 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:45 Download gff for
BO31189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6060544..6060614 | 17..87 | 100 | -> | Plus |
2L | 6060668..6060824 | 88..246 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:46 Download gff for
BO31189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6060544..6060614 | 17..87 | 100 | -> | Plus |
arm_2L | 6060668..6060824 | 88..246 | 98 | | Plus |
BO31189.pep Sequence
Translation from 16 to 262
> BO31189.pep
MLYKSLLFCLAAVLFIPAHSDAKEYQFIPARCEEQPGVGQQIGGPLSICS
FPPDYAKPDSEDIQAVIKHIKSLKLNASFLDH
BO31189.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34180-PB | 76 | CG34180-PB | 1..76 | 1..76 | 400 | 100 | Plus |