Clone BO31190 Report

Search the DGRC for BO31190

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG42718-RA
Protein status:BO31190.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO31190.complete Sequence

271 bp assembled on 2012-03-19

GenBank Submission: KX798745

> BO31190.complete
GAAGTTATCAGTCGACATGCACAGAATGCTGCTCTACACTTTGGTAATCG
TTGCCCTTGCTTTGGTTCAGGCCTGCCAAATCCATCATAATCTGACATTT
CCTGCTGTGGACCAAGTTTCCGACTGTTCTGGCCACTACCTCACTTTTGG
TAATCGGAGTTTGACAAGGGATCTGCCCACATTAACCCCAGGCAATTCGA
TGTCATCTCGGCTTGAACTTTGCTTTTATGGCAAACCTTTTACGCTGGGG
CATGCAAGCTTTCTAGACCAT

BO31190.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-RA 240 CG42718-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-RA 351 CG42718-RA 52..290 15..253 1195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16320891..16321116 253..28 1130 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:03:15 has no hits.

BO31190.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:26 Download gff for BO31190.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 54..290 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:15 Download gff for BO31190.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 54..290 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:18 Download gff for BO31190.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 54..290 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:18 Download gff for BO31190.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16320887..16321116 28..255 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:15 Download gff for BO31190.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16313987..16314216 28..255 99   Minus

BO31190.pep Sequence

Translation from 16 to 271

> BO31190.pep
MHRMLLYTLVIVALALVQACQIHHNLTFPAVDQVSDCSGHYLTFGNRSLT
RDLPTLTPGNSMSSRLELCFYGKPFTLGHASFLDH

BO31190.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-PA 79 CG42718-PA 1..79 1..79 421 100 Plus