BO31202.complete Sequence
217 bp assembled on 2012-03-19
GenBank Submission: KX796523
> BO31202.complete
GAAGTTATCAGTCGACATGTTGTTACAATCGATATTAATGAAAATATTGG
CCGTTTTTTTGGTCTGCTGGCTGGGACACGTCACAGCCCAGTCATCTGCC
GATTATATAGAGCTTGAAATTGGTTCAAGGGGTGAAGGTCCACCGGAAAA
GACGGAATTTCCCTGGGGCAATGATGACCAGGATCTTGAAGCAACATTTG
CAAGCTTTCTAGACCAT
BO31202.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:04:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43071-RC | 186 | CG43071-PC | 1..183 | 17..199 | 915 | 100 | Plus |
CG43071-RB | 186 | CG43071-PB | 1..183 | 17..199 | 915 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:04:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43071-RC | 514 | CG43071-RC | 26..208 | 17..199 | 915 | 100 | Plus |
CG43071-RB | 316 | CG43071-RB | 26..208 | 17..199 | 915 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:04:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18864927..18865056 | 199..70 | 650 | 100 | Minus |
2R | 25286936 | 2R | 18865140..18865193 | 70..17 | 270 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:04:06 has no hits.
BO31202.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:35:16 Download gff for
BO31202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RA | 1..162 | 38..201 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:42 Download gff for
BO31202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RB | 31..208 | 22..201 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:41 Download gff for
BO31202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RB | 31..208 | 22..201 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:41 Download gff for
BO31202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18864925..18865055 | 71..201 | 98 | <- | Minus |
2R | 18865140..18865188 | 22..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:42 Download gff for
BO31202.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14752430..14752560 | 71..201 | 98 | <- | Minus |
arm_2R | 14752645..14752693 | 22..70 | 100 | | Minus |
BO31202.pep Sequence
Translation from 16 to 217
> BO31202.pep
MLLQSILMKILAVFLVCWLGHVTAQSSADYIELEIGSRGEGPPEKTEFPW
GNDDQDLEATFASFLDH
BO31202.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43071-PC | 61 | CG43071-PC | 1..61 | 1..61 | 322 | 100 | Plus |
CG43071-PB | 61 | CG43071-PB | 1..61 | 1..61 | 322 | 100 | Plus |