Clone BO31202 Report

Search the DGRC for BO31202

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:312
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG43071-RA
Protein status:BO31202.pep: Imported from assembly
Sequenced Size:217

Clone Sequence Records

BO31202.complete Sequence

217 bp assembled on 2012-03-19

GenBank Submission: KX796523

> BO31202.complete
GAAGTTATCAGTCGACATGTTGTTACAATCGATATTAATGAAAATATTGG
CCGTTTTTTTGGTCTGCTGGCTGGGACACGTCACAGCCCAGTCATCTGCC
GATTATATAGAGCTTGAAATTGGTTCAAGGGGTGAAGGTCCACCGGAAAA
GACGGAATTTCCCTGGGGCAATGATGACCAGGATCTTGAAGCAACATTTG
CAAGCTTTCTAGACCAT

BO31202.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-RC 186 CG43071-PC 1..183 17..199 915 100 Plus
CG43071-RB 186 CG43071-PB 1..183 17..199 915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-RC 514 CG43071-RC 26..208 17..199 915 100 Plus
CG43071-RB 316 CG43071-RB 26..208 17..199 915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18864927..18865056 199..70 650 100 Minus
2R 25286936 2R 18865140..18865193 70..17 270 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:04:06 has no hits.

BO31202.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:35:16 Download gff for BO31202.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RA 1..162 38..201 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:42 Download gff for BO31202.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 31..208 22..201 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:41 Download gff for BO31202.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 31..208 22..201 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:41 Download gff for BO31202.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18864925..18865055 71..201 98 <- Minus
2R 18865140..18865188 22..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:42 Download gff for BO31202.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14752430..14752560 71..201 98 <- Minus
arm_2R 14752645..14752693 22..70 100   Minus

BO31202.pep Sequence

Translation from 16 to 217

> BO31202.pep
MLLQSILMKILAVFLVCWLGHVTAQSSADYIELEIGSRGEGPPEKTEFPW
GNDDQDLEATFASFLDH

BO31202.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-PC 61 CG43071-PC 1..61 1..61 322 100 Plus
CG43071-PB 61 CG43071-PB 1..61 1..61 322 100 Plus