Clone BO31210 Report

Search the DGRC for BO31210

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:312
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG42848-RA
Protein status:BO31210.pep: Imported from assembly
Sequenced Size:321

Clone Sequence Records

BO31210.complete Sequence

321 bp assembled on 2012-03-19

> BO31210.complete
GAAGTTATCAGTCGACATGGAATGCGAAGCTGCGGAGGGACGCGATTCGA
GCGAGGCAGATGAAGAAGATGTTAGCCCAAGCGGATGCAGAAGTAAAGTA
CGAAGAGGACAAGGGTCCATGACCAGGACCAGTCTGGACTGGAGGCGCTG
CCATGGATCGGGAGGAGGTCGAGGAGCAGCAGGGCGATGGGAATTCGAGA
AGGGGCAGCATCATCAGCAACAGCAGCATAAACAAAACGACCATCAGAGC
CGCAGGAACGGAAGAACCATACACTGGACGAAATCAAACCAAAGTAAGGA
AGGAGCAAGCTTTCTAGACCA

BO31210.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 04:03:26 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 04:03:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18946718..18947005 17..304 1440 100 Plus
Blast to na_te.dros performed 2014-11-28 04:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2256..2416 153..307 167 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2290..2416 145..269 161 60.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6777..6870 175..269 157 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2359..2468 198..308 156 64.9 Plus
roo 9092 roo DM_ROO 9092bp 1086..1162 172..247 147 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6841 201..308 141 61.5 Plus
roo 9092 roo DM_ROO 9092bp 1083..1176 201..292 140 63.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2490..2539 206..254 139 78 Plus
roo 9092 roo DM_ROO 9092bp 1092..1155 198..260 137 70.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2779..2858 192..270 136 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6756..6859 201..308 134 61.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2336..2401 205..271 125 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6777..6843 201..269 124 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6796 207..282 121 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6837..6913 172..247 121 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2808..2888 206..287 119 63.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6794..6862 206..274 119 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6831..6896 207..267 119 71.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2368..2427 201..259 117 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2390..2445 205..259 115 69.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6773..6837 206..269 115 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6849..6898 198..247 115 70 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2277..2356 190..269 112 63.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1558..1601 201..243 109 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6797 193..267 109 63.7 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3290..3341 205..255 104 69.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2633..2665 205..237 102 78.8 Plus
roo 9092 roo DM_ROO 9092bp 1056..1121 195..259 102 63.6 Plus

BO31210.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:28 Download gff for BO31210.complete
Subject Subject Range Query Range Percent Splice Strand
CG42848-RA 414..700 17..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:22 Download gff for BO31210.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18946718..18947004 17..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:22 Download gff for BO31210.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18946718..18947004 17..303 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:21 Download gff for BO31210.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18946718..18947004 17..303 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:21 Download gff for BO31210.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18946718..18947004 17..303 100   Plus

BO31210.pep Sequence

Translation from 16 to 319

> BO31210.pep
MECEAAEGRDSSEADEEDVSPSGCRSKVRRGQGSMTRTSLDWRRCHGSGG
GRGAAGRWEFEKGQHHQQQQHKQNDHQSRRNGRTIHWTKSNQSKEGASFL
D
Sequence BO31210.pep has no blast hits.