Clone BO31213 Report

Search the DGRC for BO31213

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:312
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG42634-RA
Protein status:BO31213.pep: Imported from assembly
Sequenced Size:376

Clone Sequence Records

BO31213.complete Sequence

376 bp assembled on 2012-03-19

GenBank Submission: KX797276

> BO31213.complete
GAAGTTATCAGTCGACATGTCCTCGTCTGTGGATCACGTGGTACACCACG
TACTGGCCCCAATGGCAATCAACGTCCTCGATCGCGTGGTGCCAGTAATC
CGCCAATTGGTGATCATCATGCATCAGGCATTTCTGGTTGATCACCATGT
GTCGGAGCCCGTGATCGATGTATCCGGCATGATTCAGCCCGTTCGTAAAA
TAGTCTTGATTGTAAACGATTCAACGCCGGAGCACCATGTCGACCAGGAG
CAGGTGGTCAGTTCGGATGACATTAACTACCTGATAAATGAAATTTCGCG
AAGTATCCGAAACTTGGCCCGTTCGACCTATAATACCATCTCGGCGATGG
CTGGAGAGGCAAGCTTTCTAGACCAT

BO31213.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42634-RA 345 CG42634-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42635-RA 1028 CG42635-RA 59..401 16..358 1715 100 Plus
CG42634-RA 1028 CG42634-RA 59..401 16..358 1715 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007993..18008335 16..358 1715 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:03:35 has no hits.

BO31213.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:06:30 Download gff for BO31213.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 60..401 17..360 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:26 Download gff for BO31213.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 60..401 17..360 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:25 Download gff for BO31213.complete
Subject Subject Range Query Range Percent Splice Strand
CG42634-RA 60..401 17..360 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:25 Download gff for BO31213.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007994..18008335 17..360 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:26 Download gff for BO31213.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18007994..18008335 17..360 99   Plus

BO31213.pep Sequence

Translation from 16 to 376

> BO31213.pep
MSSSVDHVVHHVLAPMAINVLDRVVPVIRQLVIIMHQAFLVDHHVSEPVI
DVSGMIQPVRKIVLIVNDSTPEHHVDQEQVVSSDDINYLINEISRSIRNL
ARSTYNTISAMAGEASFLDH

BO31213.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42634-PA 114 CG42634-PA 1..114 1..114 568 100 Plus