Clone BO31285 Report

Search the DGRC for BO31285

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:312
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG14563-RA
Protein status:BO31285.pep: Imported from assembly
Sequenced Size:415

Clone Sequence Records

BO31285.complete Sequence

415 bp assembled on 2012-03-19

GenBank Submission: KX797513

> BO31285.complete
GAAGTTATCAGTCGACATGGCCAGAAAAATCATGTCAGTGAAACAGTCGA
GCCGCTCTCCATGTTGTTGGTTCGGTTTGCTCCTGGTCGCCATTTTCCTG
CAGCCATCCGCGAGCCAATACTACGGTTATCCCTATTACGGCGGCGCTAA
TGCGGGAGCGGGATCGGGATACGGGAACATATACGGCAGCGGCATGTACG
GATACCCCTACAGCTACGGCGGATATCCGTACTACTCGTATCCCGGCTAC
AACCCGTACTCGATGTACGGTGGATACGGGCAGTACGGATACCCCTATGG
AGGATATCCCTACGGCGGCAATGGCATGAACGTGGCCTACGCCAGCAGCA
GTGGAGGATTCGCAACAGCCAGTGCGGGTGGAAGCGGATACTACGGCGCA
AGCTTTCTAGACCAT

BO31285.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-RA 369 CG14563-PA 1..366 32..397 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-RA 499 CG14563-RA 15..397 15..397 1915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21842058..21842372 329..15 1575 100 Minus
3L 28110227 3L 21841910..21841977 397..330 340 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:04:20 has no hits.

BO31285.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:12:05 Download gff for BO31285.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 17..397 17..399 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:50 Download gff for BO31285.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 17..397 17..399 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:49 Download gff for BO31285.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 17..397 17..399 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:49 Download gff for BO31285.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21841908..21841977 330..399 97 <- Minus
3L 21842058..21842370 17..329 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:50 Download gff for BO31285.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21835158..21835470 17..329 100   Minus
arm_3L 21835008..21835077 330..399 97 <- Minus

BO31285.pep Sequence

Translation from 16 to 415

> BO31285.pep
MARKIMSVKQSSRSPCCWFGLLLVAIFLQPSASQYYGYPYYGGANAGAGS
GYGNIYGSGMYGYPYSYGGYPYYSYPGYNPYSMYGGYGQYGYPYGGYPYG
GNGMNVAYASSSGGFATASAGGSGYYGASFLDH

BO31285.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-PA 122 CG14563-PA 1..122 6..127 698 100 Plus
CG9269-PA 146 CG9269-PA 48..144 37..129 142 43.8 Plus