Clone BO31323 Report

Search the DGRC for BO31323

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:23
Vector:pDNR-Dual
Associated Gene/Transcriptpallidin-RD
Protein status:BO31323.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO31323.complete Sequence

271 bp assembled on 2012-03-26

GenBank Submission: KX797653

> BO31323.complete
GAAGTTATCAGTCGACATGTTGAAGAGCAGCAATATAAATAGTGTCCTCA
ACGAACTCCCTAATGACCCAGCAAGGGATTCCACCGCCCAATCTTCTCAC
AATGGAAAACCAAAACAAGATGCGGAAACCTGTTGCTCCTCCCAGGACAA
CGAAGTCATGGCCAGTCTAGCCGCTTTACAGTTGTCCGCTGGCGTCCTGC
AAATAGCGGAGCCTCCACTAAACCATGTGCGCACCCAGCTTAGGGAATTG
ATGGCAAGCTTTCTAGACCAT

BO31323.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Pallidin-RB 504 CG14133-PB 1..236 17..252 1180 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
Pallidin-RB 952 CG14133-RB 67..302 17..252 1180 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11691039..11691252 253..40 1070 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:11:42 has no hits.

BO31323.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:50 Download gff for BO31323.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RD 72..303 22..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:42 Download gff for BO31323.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RD 72..303 22..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:08 Download gff for BO31323.complete
Subject Subject Range Query Range Percent Splice Strand
Pallidin-RB 72..303 22..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:08 Download gff for BO31323.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691037..11691249 43..255 99 <- Minus
3L 11691308..11691328 22..42 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:42 Download gff for BO31323.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11684137..11684349 43..255 99 <- Minus
arm_3L 11684408..11684428 22..42 100   Minus

BO31323.pep Sequence

Translation from 16 to 271

> BO31323.pep
MLKSSNINSVLNELPNDPARDSTAQSSHNGKPKQDAETCCSSQDNEVMAS
LAALQLSAGVLQIAEPPLNHVRTQLRELMASFLDH

BO31323.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
Pallidin-PB 167 CG14133-PB 1..79 1..79 394 98.7 Plus