Clone BO31327 Report

Search the DGRC for BO31327

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG30154-RA
Protein status:BO31327.pep: Imported from assembly
Sequenced Size:226

Clone Sequence Records

BO31327.complete Sequence

226 bp assembled on 2012-03-26

GenBank Submission: KX799904

> BO31327.complete
GAAGTTATCAGTCGACATGTACCTACGTCAACAACTCTGGGTTCTCTTGC
TCTGGCTCTGCTTCGTCGTTCTCAGCGTGCATGGCATGCCGTGGAAATGG
GGACCTGCCTCCAATTCTGGACCCCATGGCGGACCCGCCTGGAATGGCGG
AGAAGAGTCCACCGACAATATAGTCATCCATTCGAAAAACAGCGGCAAGT
GGCGTTACGCAAGCTTTCTAGACCAT

BO31327.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-RA 195 CG30154-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-RA 507 CG30154-RA 33..225 16..208 965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20533521..20533652 77..208 660 100 Plus
2R 25286936 2R 20533391..20533452 16..77 310 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:12:23 has no hits.

BO31327.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:57 Download gff for BO31327.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 19..210 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:00 Download gff for BO31327.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 35..226 17..210 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:24 Download gff for BO31327.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 34..225 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:24 Download gff for BO31327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20533392..20533452 17..77 100 -> Plus
2R 20533522..20533652 78..210 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:00 Download gff for BO31327.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16420897..16420957 17..77 100 -> Plus
arm_2R 16421027..16421157 78..210 98   Plus

BO31327.pep Sequence

Translation from 16 to 226

> BO31327.pep
MYLRQQLWVLLLWLCFVVLSVHGMPWKWGPASNSGPHGGPAWNGGEESTD
NIVIHSKNSGKWRYASFLDH

BO31327.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-PA 64 CG30154-PA 1..64 1..64 373 100 Plus