BO31327.complete Sequence
226 bp assembled on 2012-03-26
GenBank Submission: KX799904
> BO31327.complete
GAAGTTATCAGTCGACATGTACCTACGTCAACAACTCTGGGTTCTCTTGC
TCTGGCTCTGCTTCGTCGTTCTCAGCGTGCATGGCATGCCGTGGAAATGG
GGACCTGCCTCCAATTCTGGACCCCATGGCGGACCCGCCTGGAATGGCGG
AGAAGAGTCCACCGACAATATAGTCATCCATTCGAAAAACAGCGGCAAGT
GGCGTTACGCAAGCTTTCTAGACCAT
BO31327.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:12:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30154-RA | 195 | CG30154-PA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:12:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30154-RA | 507 | CG30154-RA | 33..225 | 16..208 | 965 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20533521..20533652 | 77..208 | 660 | 100 | Plus |
2R | 25286936 | 2R | 20533391..20533452 | 16..77 | 310 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:12:23 has no hits.
BO31327.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:57 Download gff for
BO31327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 19..210 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:00 Download gff for
BO31327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 35..226 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:24 Download gff for
BO31327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 34..225 | 17..210 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:24 Download gff for
BO31327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20533392..20533452 | 17..77 | 100 | -> | Plus |
2R | 20533522..20533652 | 78..210 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:00 Download gff for
BO31327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16420897..16420957 | 17..77 | 100 | -> | Plus |
arm_2R | 16421027..16421157 | 78..210 | 98 | | Plus |
BO31327.pep Sequence
Translation from 16 to 226
> BO31327.pep
MYLRQQLWVLLLWLCFVVLSVHGMPWKWGPASNSGPHGGPAWNGGEESTD
NIVIHSKNSGKWRYASFLDH
BO31327.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:05:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30154-PA | 64 | CG30154-PA | 1..64 | 1..64 | 373 | 100 | Plus |