BO31329.complete Sequence
616 bp assembled on 2012-03-26
GenBank Submission: KX795167
> BO31329.complete
GAAGTTATCAGTCGACATGTTCCGCGCTCAACGTGTTTGCTTTTACTTTA
TAGCTTTCCTGGCCTTCGCAGCTGCCAGACCTAAAATAAACTCGCAAATT
TCCCAAAATCAAGTTGGATTTCGATTGTCCAATGTTTTGACCAAAGAAAG
TGTTGCTTCCAAGTCATCAATGTCCACAGAGGCAACCAGTGAACCATCCA
CTGTGACTTCTGACGTGCCCACACTAACTTCACCATCATCATCATCATCT
GAGGAAACTAGTGAAGCACCTGAAAGTTCCAGCCAGCAACTATCACCATT
GACTGAAAGCTCCAGCGAAAAGGTATTTGAGGTGACCACAGTACCTTCAT
CTTCGTCGGCGGAAACTAGTGAAGCATCTGAGACTTCTAAGGCATTCACC
GAAACAACCACCACCACGGAAAGTGACGTGACATCTGAAGATTCCACCGA
AGATGAGTCATCTGAAGATTCCACCGAAGATGAGTCATCTGAAGATTCCT
CCGAAGATGAGAGCTCCGAATCAAGTGAGGAATCAGAGGAAGGATCGTAC
TACTATGATGATTCGGAATACGACTACTACGATAGTTACTTATATTATGC
AAGCTTTCTAGACCAT
BO31329.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 04:12:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:12:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4267-RB | 2182 | CG4267-RB | 1581..2162 | 17..598 | 2910 | 100 | Plus |
CG4267-RB | 2182 | CG4267-RB | 1996..2048 | 459..511 | 250 | 98.1 | Plus |
CG4267-RB | 2182 | CG4267-RB | 2023..2075 | 432..484 | 250 | 98.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2244673..2245254 | 17..598 | 2910 | 100 | Plus |
2L | 23513712 | 2L | 2245088..2245140 | 459..511 | 250 | 98.1 | Plus |
2L | 23513712 | 2L | 2245115..2245167 | 432..484 | 250 | 98.1 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:12:30 has no hits.
BO31329.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:58 Download gff for
BO31329.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31686-RA | 42..618 | 22..600 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:04 Download gff for
BO31329.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4267-RB | 1586..2162 | 22..600 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:28 Download gff for
BO31329.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4267-RB | 1586..2162 | 22..600 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:28 Download gff for
BO31329.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2244678..2245254 | 22..600 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:04 Download gff for
BO31329.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2244678..2245254 | 22..600 | 99 | | Plus |
BO31329.pep Sequence
Translation from 16 to 616
> BO31329.pep
MFRAQRVCFYFIAFLAFAAARPKINSQISQNQVGFRLSNVLTKESVASKS
SMSTEATSEPSTVTSDVPTLTSPSSSSSEETSEAPESSSQQLSPLTESSS
EKVFEVTTVPSSSSAETSEASETSKAFTETTTTTESDVTSEDSTEDESSE
DSTEDESSEDSSEDESSESSEESEEGSYYYDDSEYDYYDSYLYYASFLDH
BO31329.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ppn-PC | 2174 | CG33103-PC | 780..942 | 38..186 | 187 | 36.8 | Plus |
Ppn-PF | 2776 | CG33103-PF | 780..942 | 38..186 | 187 | 36.8 | Plus |
Ppn-PG | 2841 | CG33103-PG | 780..942 | 38..186 | 187 | 36.8 | Plus |
Ppn-PE | 2898 | CG33103-PE | 780..942 | 38..186 | 187 | 36.8 | Plus |
Muc68D-PB | 1514 | CG6004-PB | 303..448 | 42..176 | 180 | 37.6 | Plus |
Ppn-PC | 2174 | CG33103-PC | 876..1012 | 42..177 | 163 | 35.7 | Plus |
Ppn-PF | 2776 | CG33103-PF | 876..1012 | 42..177 | 163 | 35.7 | Plus |
Ppn-PG | 2841 | CG33103-PG | 876..1012 | 42..177 | 163 | 35.7 | Plus |
Ppn-PE | 2898 | CG33103-PE | 876..1012 | 42..177 | 163 | 35.7 | Plus |
Ppn-PC | 2174 | CG33103-PC | 894..1027 | 42..173 | 154 | 29.9 | Plus |
Ppn-PC | 2174 | CG33103-PC | 946..1074 | 45..177 | 154 | 33.6 | Plus |
Ppn-PF | 2776 | CG33103-PF | 894..1027 | 42..173 | 154 | 29.9 | Plus |
Ppn-PF | 2776 | CG33103-PF | 946..1074 | 45..177 | 154 | 33.6 | Plus |
Ppn-PG | 2841 | CG33103-PG | 894..1027 | 42..173 | 154 | 29.9 | Plus |
Ppn-PG | 2841 | CG33103-PG | 946..1074 | 45..177 | 154 | 33.6 | Plus |
Ppn-PE | 2898 | CG33103-PE | 894..1027 | 42..173 | 154 | 29.9 | Plus |
Ppn-PE | 2898 | CG33103-PE | 946..1074 | 45..177 | 154 | 33.6 | Plus |
Ppn-PC | 2174 | CG33103-PC | 951..1092 | 42..174 | 150 | 34.3 | Plus |
Ppn-PF | 2776 | CG33103-PF | 951..1092 | 42..174 | 150 | 34.3 | Plus |
Ppn-PG | 2841 | CG33103-PG | 951..1092 | 42..174 | 150 | 34.3 | Plus |
Ppn-PE | 2898 | CG33103-PE | 951..1092 | 42..174 | 150 | 34.3 | Plus |
Ppn-PC | 2174 | CG33103-PC | 916..1062 | 38..177 | 148 | 31.5 | Plus |
Ppn-PF | 2776 | CG33103-PF | 916..1062 | 38..177 | 148 | 31.5 | Plus |
Ppn-PG | 2841 | CG33103-PG | 916..1062 | 38..177 | 148 | 31.5 | Plus |
Ppn-PE | 2898 | CG33103-PE | 916..1062 | 38..177 | 148 | 31.5 | Plus |
Ppn-PC | 2174 | CG33103-PC | 828..967 | 37..174 | 147 | 28.6 | Plus |
Ppn-PC | 2174 | CG33103-PC | 865..1010 | 51..184 | 147 | 34.7 | Plus |
Ppn-PF | 2776 | CG33103-PF | 828..967 | 37..174 | 147 | 28.6 | Plus |
Ppn-PF | 2776 | CG33103-PF | 865..1010 | 51..184 | 147 | 34.7 | Plus |
Ppn-PG | 2841 | CG33103-PG | 828..967 | 37..174 | 147 | 28.6 | Plus |
Ppn-PG | 2841 | CG33103-PG | 865..1010 | 51..184 | 147 | 34.7 | Plus |
Ppn-PE | 2898 | CG33103-PE | 828..967 | 37..174 | 147 | 28.6 | Plus |
Ppn-PE | 2898 | CG33103-PE | 865..1010 | 51..184 | 147 | 34.7 | Plus |