Clone BO31331 Report

Search the DGRC for BO31331

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG42561-RA
Protein status:BO31331.pep: Imported from assembly
Sequenced Size:418

Clone Sequence Records

BO31331.complete Sequence

418 bp assembled on 2012-03-26

GenBank Submission: KX796806

> BO31331.complete
GAAGTTATCAGTCGACATGTCTCGCGATTTTTTCGCGCTGTTGGCAATTT
TCATCTTCACTGCGGTCAACGCGGCACCGCAAATTTCACCAACTATCGTT
CCGCAAATCCGCACAAATGGCTTTCAACTTGAGCCCCTCAATCAAGAATA
CTTTCTCAGAATCGAACATCCGGGTGGCACTATTCGCCAGGAATCCGTGA
GCCAGAATGAAGCCGGACATCTGCAGGTTAAAGGTGTGATTAACCAGCCC
TTCGAGGATCAGGATGCCAATCTTATTGTCACCTATGAGGCTGGTCCGAA
TGGATATGTTGCCAAATACAGCTTCGGCAAGGGTCCTCCAACACCGCCTC
CTGACACACCATTATTCCTCAGTCCCGGTGCTCTGAAAACTGCAGCGGGA
GCAAGCTTTCTAGACCAT

BO31331.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-RA 387 CG42561-PA 1..384 17..400 1920 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-RA 566 CG42561-RA 29..413 16..400 1925 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17685153..17685395 158..400 1215 100 Plus
2R 25286936 2R 17684973..17685095 37..159 615 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:12:38 has no hits.

BO31331.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:59 Download gff for BO31331.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 167..550 17..402 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:07 Download gff for BO31331.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 30..413 17..402 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:31 Download gff for BO31331.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 30..413 17..402 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:31 Download gff for BO31331.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17685155..17685395 160..402 99   Plus
2R 17684884..17684904 17..37 100 -> Plus
2R 17684974..17685095 38..159 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:07 Download gff for BO31331.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13572389..13572409 17..37 100 -> Plus
arm_2R 13572479..13572600 38..159 100 -> Plus
arm_2R 13572660..13572900 160..402 99   Plus

BO31331.pep Sequence

Translation from 16 to 418

> BO31331.pep
MSRDFFALLAIFIFTAVNAAPQISPTIVPQIRTNGFQLEPLNQEYFLRIE
HPGGTIRQESVSQNEAGHLQVKGVINQPFEDQDANLIVTYEAGPNGYVAK
YSFGKGPPTPPPDTPLFLSPGALKTAAGASFLDH

BO31331.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-PA 128 CG42561-PA 1..128 1..128 669 100 Plus
CG42562-PA 126 CG42562-PA 8..126 7..128 182 43.9 Plus