BO31332.complete Sequence
310 bp assembled on 2012-03-26
GenBank Submission: KX797413
> BO31332.complete
GAAGTTATCAGTCGACATGAAATTCCTTCTGATCCTGGCCAGTGTGGTCC
TCTATGTGGCCCTCAGCTCTGCTCAGTCTTGCCCAGGACGTCCATCCCAT
CAGAACTGCTTACACGGGAAGGACGAAGGAGTTGAACGCGCAAGGCATTG
TAATAGGGATCCCAATCCACAGATGTGGTACTACAACCAACGTGAAAATA
GGTGCATCAAGATGAGGTACCTCGGCTGTAAGGGCAACCGCAATCGTTAT
TGCACATTGAACGAGTGTCAAAGGAAATGCGTTCGACGATCAGCAAGCTT
TCTAGACCAT
BO31332.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:12:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42713-RA | 279 | CG42713-PA | 1..276 | 17..292 | 1380 | 100 | Plus |
| CG42713-RB | 279 | CG42713-PB | 1..276 | 17..292 | 1380 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:12:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42713-RA | 674 | CG42713-RA | 66..343 | 15..292 | 1390 | 100 | Plus |
| CG42713-RB | 424 | CG42713-RB | 66..343 | 15..292 | 1390 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 8891653..8891849 | 96..292 | 985 | 100 | Plus |
| 2L | 23513712 | 2L | 8891505..8891585 | 15..95 | 405 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:12:42 has no hits.
BO31332.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:00 Download gff for
BO31332.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42713-RA | 19..294 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:08 Download gff for
BO31332.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42713-RB | 68..343 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:34 Download gff for
BO31332.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42713-RB | 68..343 | 17..294 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:34 Download gff for
BO31332.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 8891507..8891585 | 17..95 | 100 | -> | Plus |
| 2L | 8891653..8891849 | 96..294 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:08 Download gff for
BO31332.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 8891507..8891585 | 17..95 | 100 | -> | Plus |
| arm_2L | 8891653..8891849 | 96..294 | 98 | | Plus |
BO31332.pep Sequence
Translation from 16 to 310
> BO31332.pep
MKFLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNRDPN
PQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKCVRRSASFLDH
BO31332.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42713-PA | 92 | CG42713-PA | 1..92 | 1..92 | 516 | 100 | Plus |
| CG42713-PB | 92 | CG42713-PB | 1..92 | 1..92 | 516 | 100 | Plus |
| CG42537-PA | 90 | CG42537-PA | 1..89 | 1..88 | 266 | 56.7 | Plus |
| CG42538-PA | 89 | CG42538-PA | 1..86 | 1..86 | 244 | 52.3 | Plus |
| CG42717-PA | 96 | CG42717-PA | 9..90 | 4..85 | 171 | 32.9 | Plus |
