Clone BO31338 Report

Search the DGRC for BO31338

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG42779-RA
Protein status:BO31338.pep: Imported from assembly
Sequenced Size:217

Clone Sequence Records

BO31338.complete Sequence

217 bp assembled on 2012-03-26

GenBank Submission: KX796705

> BO31338.complete
GAAGTTATCAGTCGACATGAAGTTTTTTGCCATCCTCCTCCTTTTGTGCA
CCATGGTAGCTGTTGCAATTGCCGCAACAACCACAACCACAACGGAGAAC
ATTGATTGGGGTTCTGCAAGTACAACTGAAATACCGGCAACAACTACAGC
AACTCCATGTGAATCAGCTGACGCCAAGAAATTATATTTCTTTTATAAAG
CAAGCTTTCTAGACCAT

BO31338.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-RA 186 CG42779-PA 1..183 17..199 885 98.9 Plus
CG42779-RB 186 CG42779-PB 1..183 17..199 885 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-RA 256 CG42779-RA 15..199 15..199 895 98.9 Plus
CG42779-RB 511 CG42779-RB 15..199 15..199 895 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17121591..17121775 15..199 895 98.9 Plus
Blast to na_te.dros performed on 2014-11-28 04:13:00 has no hits.

BO31338.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:03 Download gff for BO31338.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 1..183 17..201 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:17 Download gff for BO31338.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 17..199 17..201 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:44 Download gff for BO31338.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RB 17..199 17..201 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:44 Download gff for BO31338.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17121593..17121775 17..201 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:17 Download gff for BO31338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12947315..12947497 17..201 97   Plus

BO31338.pep Sequence

Translation from 16 to 217

> BO31338.pep
MKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTATPCES
ADAKKLYFFYKASFLDH

BO31338.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-PA 61 CG42779-PA 1..61 1..61 311 100 Plus
CG42779-PB 61 CG42779-PB 1..61 1..61 311 100 Plus