BO31338.complete Sequence
217 bp assembled on 2012-03-26
GenBank Submission: KX796705
> BO31338.complete
GAAGTTATCAGTCGACATGAAGTTTTTTGCCATCCTCCTCCTTTTGTGCA
CCATGGTAGCTGTTGCAATTGCCGCAACAACCACAACCACAACGGAGAAC
ATTGATTGGGGTTCTGCAAGTACAACTGAAATACCGGCAACAACTACAGC
AACTCCATGTGAATCAGCTGACGCCAAGAAATTATATTTCTTTTATAAAG
CAAGCTTTCTAGACCAT
BO31338.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-RA | 186 | CG42779-PA | 1..183 | 17..199 | 885 | 98.9 | Plus |
CG42779-RB | 186 | CG42779-PB | 1..183 | 17..199 | 885 | 98.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-RA | 256 | CG42779-RA | 15..199 | 15..199 | 895 | 98.9 | Plus |
CG42779-RB | 511 | CG42779-RB | 15..199 | 15..199 | 895 | 98.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17121591..17121775 | 15..199 | 895 | 98.9 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:13:00 has no hits.
BO31338.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:03 Download gff for
BO31338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 1..183 | 17..201 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:17 Download gff for
BO31338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 17..199 | 17..201 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:44 Download gff for
BO31338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RB | 17..199 | 17..201 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:44 Download gff for
BO31338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17121593..17121775 | 17..201 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:17 Download gff for
BO31338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 12947315..12947497 | 17..201 | 97 | | Plus |
BO31338.pep Sequence
Translation from 16 to 217
> BO31338.pep
MKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTATPCES
ADAKKLYFFYKASFLDH
BO31338.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-PA | 61 | CG42779-PA | 1..61 | 1..61 | 311 | 100 | Plus |
CG42779-PB | 61 | CG42779-PB | 1..61 | 1..61 | 311 | 100 | Plus |