Clone BO31341 Report

Search the DGRC for BO31341

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptEig71Ek-RA
Protein status:BO31341.pep: Imported from assembly
Sequenced Size:325

Clone Sequence Records

BO31341.complete Sequence

325 bp assembled on 2012-03-26

GenBank Submission: KX793969

> BO31341.complete
GAAGTTATCAGTCGACATGTGGAAAATATTCTTGCTGTTGGTTCTTTGTA
TCCTGCAATTGTGCCACATTGATGCTCAATGGAGTCGAGTGTACTGTGAG
AATATCTATAACGATTGTCAACGATTTACATCCAGAATAGGACGATTTGA
TGAGACTATAGATTCCTTTAATCGTCATTGTCGTCGGGAGCGCAGAGGAA
GGTGGAACAGTGTGTCTCGATGTGAAATGGAAAAAGCCACCTGTCTTCTG
ATTTTTCGACGCTGTGATGATATGTCCTGTAACAACATTGCAGATGTCTT
GGAATTGGCAAGCTTTCTAGACCAT

BO31341.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-RA 294 CG7325-PA 1..291 17..307 1455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-RA 445 CG7325-RA 25..315 17..307 1455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15661357..15661564 41..248 1040 100 Plus
3L 28110227 3L 15661621..15661679 249..307 295 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:13:07 has no hits.

BO31341.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:05 Download gff for BO31341.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 25..315 17..309 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:21 Download gff for BO31341.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 25..315 17..309 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:47 Download gff for BO31341.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 25..315 17..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:47 Download gff for BO31341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15661272..15661296 17..41 100 -> Plus
3L 15661358..15661564 42..248 100 -> Plus
3L 15661621..15661679 249..309 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:21 Download gff for BO31341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15654372..15654396 17..41 100 -> Plus
arm_3L 15654458..15654664 42..248 100 -> Plus
arm_3L 15654721..15654779 249..309 96   Plus

BO31341.pep Sequence

Translation from 16 to 325

> BO31341.pep
MWKIFLLLVLCILQLCHIDAQWSRVYCENIYNDCQRFTSRIGRFDETIDS
FNRHCRRERRGRWNSVSRCEMEKATCLLIFRRCDDMSCNNIADVLELASF
LDH

BO31341.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-PA 97 CG7325-PA 1..97 1..97 538 100 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 1..95 190 35.1 Plus
Eig71Eb-PB 95 CG7355-PB 1..93 1..95 160 36.5 Plus
Eig71Eb-PA 95 CG7355-PA 1..93 1..95 160 36.5 Plus
Eig71Ei-PB 102 CG7327-PB 1..101 1..97 151 33.3 Plus