BO31347.complete Sequence
259 bp assembled on 2012-03-26
> BO31347.complete
GAAGTTATCAGTCGACATGTGGCTTCTCTTGCTCCTGCTGGGTCTGCCGA
TGGAAACAAACGAAGGAGAGGAGTGCAGAAATGGACTAACTCTCGGACGC
CAGCAGTGCTACCTCCACGAGGAGATCTTTCTAGCCCACCACCCTTTGCA
AAGTGTCACAGCCAAGAGGCTCAAGCTTCCCTGGTGGTGCGCCCTCCTAG
AAAGCCTCTTCCTGCTCCTGCTGGTGAAGCTGCTCCAGTTGGTAAGCTTT
CTAGACCAT
BO31347.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:12:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42851-RB | 195 | CG42851-PB | 1..192 | 50..241 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:12:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42851-RB | 783 | CG42851-RB | 104..329 | 16..241 | 1130 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24809428..24809653 | 16..241 | 1130 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 04:12:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\TART | 8444 | Dyak\TART TARTYAK 8444bp | 6396..6449 | 243..194 | 108 | 70.4 | Minus |
TART-C | 11124 | TART-C TARTC 11124bp | 7852..7905 | 243..194 | 108 | 70.4 | Minus |
BO31347.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:02 Download gff for
BO31347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42851-RA | 82..307 | 17..243 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:14 Download gff for
BO31347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42851-RA | 105..330 | 17..243 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:40 Download gff for
BO31347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42851-RB | 105..330 | 17..243 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:40 Download gff for
BO31347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24809429..24809654 | 17..243 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:14 Download gff for
BO31347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 20696952..20697177 | 17..243 | 99 | | Plus |
BO31347.pep Sequence
Translation from 16 to 259
> BO31347.pep
MWLLLLLLGLPMETNEGEECRNGLTLGRQQCYLHEEIFLAHHPLQSVTAK
RLKLPWWCALLESLFLLLLVKLLQLVSFLDH
BO31347.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42851-PB | 64 | CG42851-PB | 1..64 | 12..75 | 341 | 100 | Plus |