Clone BO31347 Report

Search the DGRC for BO31347

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG42851-RA
Protein status:BO31347.pep: Imported from assembly
Sequenced Size:259

Clone Sequence Records

BO31347.complete Sequence

259 bp assembled on 2012-03-26

> BO31347.complete
GAAGTTATCAGTCGACATGTGGCTTCTCTTGCTCCTGCTGGGTCTGCCGA
TGGAAACAAACGAAGGAGAGGAGTGCAGAAATGGACTAACTCTCGGACGC
CAGCAGTGCTACCTCCACGAGGAGATCTTTCTAGCCCACCACCCTTTGCA
AAGTGTCACAGCCAAGAGGCTCAAGCTTCCCTGGTGGTGCGCCCTCCTAG
AAAGCCTCTTCCTGCTCCTGCTGGTGAAGCTGCTCCAGTTGGTAAGCTTT
CTAGACCAT

BO31347.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42851-RB 195 CG42851-PB 1..192 50..241 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42851-RB 783 CG42851-RB 104..329 16..241 1130 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24809428..24809653 16..241 1130 100 Plus
Blast to na_te.dros performed 2014-11-28 04:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 6396..6449 243..194 108 70.4 Minus
TART-C 11124 TART-C TARTC 11124bp 7852..7905 243..194 108 70.4 Minus

BO31347.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:02 Download gff for BO31347.complete
Subject Subject Range Query Range Percent Splice Strand
CG42851-RA 82..307 17..243 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:14 Download gff for BO31347.complete
Subject Subject Range Query Range Percent Splice Strand
CG42851-RA 105..330 17..243 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:40 Download gff for BO31347.complete
Subject Subject Range Query Range Percent Splice Strand
CG42851-RB 105..330 17..243 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:40 Download gff for BO31347.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24809429..24809654 17..243 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:14 Download gff for BO31347.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20696952..20697177 17..243 99   Plus

BO31347.pep Sequence

Translation from 16 to 259

> BO31347.pep
MWLLLLLLGLPMETNEGEECRNGLTLGRQQCYLHEEIFLAHHPLQSVTAK
RLKLPWWCALLESLFLLLLVKLLQLVSFLDH

BO31347.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42851-PB 64 CG42851-PB 1..64 12..75 341 100 Plus