Clone BO31349 Report

Search the DGRC for BO31349

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG43103-RA
Protein status:BO31349.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO31349.complete Sequence

265 bp assembled on 2012-03-26

GenBank Submission: KX798309

> BO31349.complete
GAAGTTATCAGTCGACATGCTATCAAGATCCGTGCTGATCGTAGTAGGCC
TACTAATGCTGAGCTGGCAGTGGACGATGGCCATGCCGCCCCTTCCGAAG
AACCAACCCAGCGGAGTATCTATTAGTCAGCCCGATATACCGGGAGCCTC
GGATATTTTGGTGCAGAGCATCTTCAACATCGATCCATCGCTGTGTCCCA
AGGGGTACATACGCACGGGTCCACATCACACGTGTCGTAGGATAGCCGCA
AGCTTTCTAGACCAT

BO31349.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-RA 234 CG43103-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-RA 482 CG43103-RA 60..290 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17139642..17139872 247..17 1155 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:13:32 has no hits.

BO31349.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:09 Download gff for BO31349.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 54..284 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:33 Download gff for BO31349.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 54..284 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:57 Download gff for BO31349.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 60..290 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:57 Download gff for BO31349.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17139640..17139872 17..249 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:33 Download gff for BO31349.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13027145..13027377 17..249 99   Minus

BO31349.pep Sequence

Translation from 16 to 265

> BO31349.pep
MLSRSVLIVVGLLMLSWQWTMAMPPLPKNQPSGVSISQPDIPGASDILVQ
SIFNIDPSLCPKGYIRTGPHHTCRRIAASFLDH

BO31349.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-PA 77 CG43103-PA 1..77 1..77 409 100 Plus