BO31350.complete Sequence
298 bp assembled on 2012-03-26
GenBank Submission: KX798599
> BO31350.complete
GAAGTTATCAGTCGACATGACCGATACCAGTGCAAATAATTTGGATGTAT
CGGTGGATGTGGTCTGGCCGACGATAATTGTCCTGGCCATGCTGGTCATA
AATGGCTTCGTTTTCGCCTACATTATGCGCAAGCGGCGGGAATACAAATG
CCAGGAGGAGGAGCTGCAGCAACAACAACAACCTGTTCCACATTCCTCCT
ATGCGGCCACTTCGACAACGGAACGGCATGCGGATGCGGATCAGGAGGAC
GATAGCTGTGCCATCGAGATGGAGCGACTGGCAAGCTTTCTAGACCAT
BO31350.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42806-RB | 267 | CG42806-PB | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42806-RB | 803 | CG42806-RB | 267..530 | 17..280 | 1320 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:13:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13964919..13965182 | 17..280 | 1320 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 04:13:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 973..1014 | 144..185 | 102 | 71.4 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1127..1159 | 152..184 | 102 | 78.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2400..2430 | 152..182 | 101 | 80.6 | Plus |
BO31350.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:09 Download gff for
BO31350.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42806-RB | 252..515 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:35 Download gff for
BO31350.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42806-RB | 267..530 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:59 Download gff for
BO31350.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42806-RB | 267..530 | 17..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:59 Download gff for
BO31350.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13964919..13965182 | 17..282 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:35 Download gff for
BO31350.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 9852424..9852687 | 17..282 | 99 | | Plus |
BO31350.pep Sequence
Translation from 16 to 298
> BO31350.pep
MTDTSANNLDVSVDVVWPTIIVLAMLVINGFVFAYIMRKRREYKCQEEEL
QQQQQPVPHSSYAATSTTERHADADQEDDSCAIEMERLASFLDH
BO31350.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42806-PB | 88 | CG42806-PB | 1..88 | 1..88 | 453 | 100 | Plus |