Clone BO31350 Report

Search the DGRC for BO31350

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG42806-RB
Protein status:BO31350.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO31350.complete Sequence

298 bp assembled on 2012-03-26

GenBank Submission: KX798599

> BO31350.complete
GAAGTTATCAGTCGACATGACCGATACCAGTGCAAATAATTTGGATGTAT
CGGTGGATGTGGTCTGGCCGACGATAATTGTCCTGGCCATGCTGGTCATA
AATGGCTTCGTTTTCGCCTACATTATGCGCAAGCGGCGGGAATACAAATG
CCAGGAGGAGGAGCTGCAGCAACAACAACAACCTGTTCCACATTCCTCCT
ATGCGGCCACTTCGACAACGGAACGGCATGCGGATGCGGATCAGGAGGAC
GATAGCTGTGCCATCGAGATGGAGCGACTGGCAAGCTTTCTAGACCAT

BO31350.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42806-RB 267 CG42806-PB 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42806-RB 803 CG42806-RB 267..530 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13964919..13965182 17..280 1320 100 Plus
Blast to na_te.dros performed 2014-11-28 04:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 973..1014 144..185 102 71.4 Plus
roo 9092 roo DM_ROO 9092bp 1127..1159 152..184 102 78.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2400..2430 152..182 101 80.6 Plus

BO31350.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:09 Download gff for BO31350.complete
Subject Subject Range Query Range Percent Splice Strand
CG42806-RB 252..515 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:35 Download gff for BO31350.complete
Subject Subject Range Query Range Percent Splice Strand
CG42806-RB 267..530 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:59 Download gff for BO31350.complete
Subject Subject Range Query Range Percent Splice Strand
CG42806-RB 267..530 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:59 Download gff for BO31350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13964919..13965182 17..282 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:35 Download gff for BO31350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9852424..9852687 17..282 99   Plus

BO31350.pep Sequence

Translation from 16 to 298

> BO31350.pep
MTDTSANNLDVSVDVVWPTIIVLAMLVINGFVFAYIMRKRREYKCQEEEL
QQQQQPVPHSSYAATSTTERHADADQEDDSCAIEMERLASFLDH

BO31350.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42806-PB 88 CG42806-PB 1..88 1..88 453 100 Plus