Clone BO31352 Report

Search the DGRC for BO31352

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG42834-RA
Protein status:BO31352.pep: Imported from assembly
Sequenced Size:400

Clone Sequence Records

BO31352.complete Sequence

400 bp assembled on 2012-03-26

GenBank Submission: KX800067

> BO31352.complete
GAAGTTATCAGTCGACATGGCTCTTCGTATTATTTTTGTCTTCATTGCCA
CAATCGTCCTGGCGCAAGGATCAAATATTTCGCCAGTTGCGCAGGAGAAT
CTTGTGCGGGTCCATCACTCTGGAGTGGTTTCATCTGGAGCTCCTGCCGT
TGGTGTTACCCAGAGCCGCTCAGTTGTTTCGCAAGCTCAGCGTCCTAACT
ATGGTCAGAGATCCATCTCTGGATCTATCGGAGGATCTCGTCGAGTGGGC
GAAGTTCCAGTGTCCGGATCTCGTCCTCATGGTGGTGCTCCTCGTCGTTC
TTCTGCAAGCGCTTATGCTCGTCCCATCGGAGGTGGAGCTACCCCAGGAT
ATGTCCACCGCAACCGCAACCAGAAACCATATGCAAGCTTTCTAGACCAT

BO31352.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-RA 369 CG42834-PA 1..366 17..382 1830 100 Plus
CG14332-RA 375 CG14332-PA 194..328 210..344 225 77.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-RA 536 CG42834-RA 27..392 17..382 1830 100 Plus
CG14332-RA 513 CG14332-RA 220..354 210..344 225 77.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17418785..17419150 17..382 1830 100 Plus
3R 32079331 3R 17421849..17421983 344..210 225 77.8 Minus
Blast to na_te.dros performed on 2014-11-28 04:13:43 has no hits.

BO31352.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:10 Download gff for BO31352.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..366 17..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:40 Download gff for BO31352.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 27..392 17..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:02 Download gff for BO31352.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 27..392 17..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:02 Download gff for BO31352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17418785..17419150 17..384 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:40 Download gff for BO31352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13244507..13244872 17..384 99   Plus

BO31352.pep Sequence

Translation from 16 to 400

> BO31352.pep
MALRIIFVFIATIVLAQGSNISPVAQENLVRVHHSGVVSSGAPAVGVTQS
RSVVSQAQRPNYGQRSISGSIGGSRRVGEVPVSGSRPHGGAPRRSSASAY
ARPIGGGATPGYVHRNRNQKPYASFLDH

BO31352.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-PA 122 CG42834-PA 1..122 1..122 616 100 Plus
CG14332-PA 124 CG14332-PA 1..124 1..122 304 54.8 Plus
CG33333-PA 148 CG33333-PA 1..88 1..103 139 39.8 Plus