Clone BO31356 Report

Search the DGRC for BO31356

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG33493-RA
Protein status:BO31356.pep: Imported from assembly
Sequenced Size:340

Clone Sequence Records

BO31356.complete Sequence

340 bp assembled on 2012-03-26

GenBank Submission: KX799106

> BO31356.complete
GAAGTTATCAGTCGACATGCGTGCGCTTCAGTACCTTCTGCTACTGCTCG
TCATCTCCATCGGCTTGGCGGCATCGGTGCCTCGCCAGCGTCGTCAGATC
GATCTCACGGTTTCGGCGGAGCACGACGACAACGATGAGGAGACGGAACT
GGCTCTGGAGGCCATCGCCGGGCTATGGAGCAGTGCGGACAGTCGGACGA
AGATCGATGGCTCTGCCAGCCTGGTGCATCGAACACATGGAACACAATCG
GGTACGGGCAGCACCAGATACCAGGCCAAACTGCATCTACACCATGACTA
TAAGACCAATGCGTATCCCTCGGCAAGCTTTCTAGACCAT

BO31356.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG33493-RA 309 CG33493-PA 1..306 17..322 1530 100 Plus
CG33493-RB 285 CG33493-PB 1..241 17..257 1190 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG33493-RA 592 CG33493-RA 43..350 15..322 1540 100 Plus
CG33493-RB 558 CG33493-RB 43..285 15..257 1200 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10692818..10693125 322..15 1540 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:13:57 has no hits.

BO31356.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:13 Download gff for BO31356.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 13..318 17..324 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:48 Download gff for BO31356.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 45..350 17..324 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:09 Download gff for BO31356.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 45..350 17..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:09 Download gff for BO31356.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10692816..10693123 17..324 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:48 Download gff for BO31356.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10685916..10686223 17..324 99   Minus

BO31356.pep Sequence

Translation from 16 to 340

> BO31356.pep
MRALQYLLLLLVISIGLAASVPRQRRQIDLTVSAEHDDNDEETELALEAI
AGLWSSADSRTKIDGSASLVHRTHGTQSGTGSTRYQAKLHLHHDYKTNAY
PSASFLDH

BO31356.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG33493-PA 102 CG33493-PA 1..102 1..102 516 100 Plus
CG33493-PB 94 CG33493-PB 1..80 1..80 388 98.8 Plus