Clone BO31357 Report

Search the DGRC for BO31357

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG12479-RA
Protein status:BO31357.pep: Imported from assembly
Sequenced Size:256

Clone Sequence Records

BO31357.complete Sequence

256 bp assembled on 2012-03-26

GenBank Submission: KX798680

> BO31357.complete
GAAGTTATCAGTCGACATGTCGACTACTCCAGAGGATCGGCTGCGTGAGA
ACATCAATCGATGCCTCTCGGATTCCCTGGTGAAGGGAGTTGGTGGTCTG
GTGATCGGATCCGTGGTCACCCTGCTCTTCTTCCGTAGGCGCATATGGCC
CGTCTGGCTGGGCACTGGATTCGGCGTGGGCGTGGCATATCGTGGCTGTG
AAAAGGAGCTCAACGATGTAAAGTTTGGCCAACGAAAGGCAAGCTTTCTA
GACCAT

BO31357.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-RA 225 CG12479-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-RA 428 CG12479-RA 93..314 17..238 1110 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14151693..14151914 238..17 1110 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:14:00 has no hits.

BO31357.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:14 Download gff for BO31357.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 93..314 17..240 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:49 Download gff for BO31357.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 93..314 17..240 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:10 Download gff for BO31357.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 93..314 17..240 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:10 Download gff for BO31357.complete
Subject Subject Range Query Range Percent Splice Strand
X 14151690..14151914 17..240 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:49 Download gff for BO31357.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14045723..14045947 17..240 99   Minus

BO31357.pep Sequence

Translation from 16 to 256

> BO31357.pep
MSTTPEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGT
GFGVGVAYRGCEKELNDVKFGQRKASFLDH

BO31357.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-PA 74 CG12479-PA 1..74 1..74 391 100 Plus
CG41128-PB 72 CG41128-PB 9..72 6..69 218 54.7 Plus
CG13564-PA 81 CG13564-PA 27..79 14..66 150 50.9 Plus