BO31357.complete Sequence
256 bp assembled on 2012-03-26
GenBank Submission: KX798680
> BO31357.complete
GAAGTTATCAGTCGACATGTCGACTACTCCAGAGGATCGGCTGCGTGAGA
ACATCAATCGATGCCTCTCGGATTCCCTGGTGAAGGGAGTTGGTGGTCTG
GTGATCGGATCCGTGGTCACCCTGCTCTTCTTCCGTAGGCGCATATGGCC
CGTCTGGCTGGGCACTGGATTCGGCGTGGGCGTGGCATATCGTGGCTGTG
AAAAGGAGCTCAACGATGTAAAGTTTGGCCAACGAAAGGCAAGCTTTCTA
GACCAT
BO31357.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:14:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12479-RA | 225 | CG12479-PA | 1..222 | 17..238 | 1110 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:14:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12479-RA | 428 | CG12479-RA | 93..314 | 17..238 | 1110 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:14:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 14151693..14151914 | 238..17 | 1110 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:14:00 has no hits.
BO31357.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:14 Download gff for
BO31357.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12479-RA | 93..314 | 17..240 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:49 Download gff for
BO31357.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12479-RA | 93..314 | 17..240 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:10 Download gff for
BO31357.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12479-RA | 93..314 | 17..240 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:10 Download gff for
BO31357.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 14151690..14151914 | 17..240 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:49 Download gff for
BO31357.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 14045723..14045947 | 17..240 | 99 | | Minus |
BO31357.pep Sequence
Translation from 16 to 256
> BO31357.pep
MSTTPEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGT
GFGVGVAYRGCEKELNDVKFGQRKASFLDH
BO31357.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12479-PA | 74 | CG12479-PA | 1..74 | 1..74 | 391 | 100 | Plus |
CG41128-PB | 72 | CG41128-PB | 9..72 | 6..69 | 218 | 54.7 | Plus |
CG13564-PA | 81 | CG13564-PA | 27..79 | 14..66 | 150 | 50.9 | Plus |