Clone BO31358 Report

Search the DGRC for BO31358

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG14143-RA
Protein status:BO31358.pep: Imported from assembly
Sequenced Size:376

Clone Sequence Records

BO31358.complete Sequence

376 bp assembled on 2012-03-26

GenBank Submission: KX799664

> BO31358.complete
GAAGTTATCAGTCGACATGCGATCCCAGCTAACTATCTTCCTTGCCATCG
CGGCTTTCGTTTCGACTGCCTGGGCACTGACTTCTCCCGCCACGGTCACT
GTTTCATCGGTCACTGTTTCATCGGTCACTATTCCATCGGTCACTATTCC
TTCGGTCACTATTCCGACCACTGATACAGACACGTCCACCACTTCGCCTT
CGGCAACCGGAAGCAGCACCACCGTGACTCCCACCACCAAGAAACCAAAG
AAGAAGGCTACCGTTGTCCACTACAAGAAGAAGACCCACAAGTCGAACCG
ACGCCGCAAGTTCCGCCACTCACGTGATGGAAAGAGGAAGAACCGATCGA
GTTGGGAAGCAAGCTTTCTAGACCAT

BO31358.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14143-RA 345 CG14143-PA 1..342 17..358 1710 100 Plus
CG32074-RA 333 CG32074-PA 1..330 17..358 1235 91.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14143-RA 494 CG14143-RA 11..352 17..358 1710 100 Plus
CG32074-RA 440 CG32074-RA 3..332 17..358 1235 91.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11134997..11135338 17..358 1710 100 Plus
3L 28110227 3L 11131991..11132320 358..17 1235 91.9 Minus
Blast to na_te.dros performed on 2014-11-28 04:13:23 has no hits.

BO31358.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:07 Download gff for BO31358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14143-RA 1..342 17..360 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:30 Download gff for BO31358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14143-RA 11..352 17..360 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:55 Download gff for BO31358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14143-RA 11..352 17..360 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:55 Download gff for BO31358.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11134997..11135338 17..360 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:30 Download gff for BO31358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11128097..11128438 17..360 99   Plus

BO31358.pep Sequence

Translation from 16 to 376

> BO31358.pep
MRSQLTIFLAIAAFVSTAWALTSPATVTVSSVTVSSVTIPSVTIPSVTIP
TTDTDTSTTSPSATGSSTTVTPTTKKPKKKATVVHYKKKTHKSNRRRKFR
HSRDGKRKNRSSWEASFLDH

BO31358.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14143-PA 114 CG14143-PA 1..114 1..114 572 100 Plus
CG32074-PA 110 CG32074-PA 1..110 1..114 501 91.3 Plus
nol-PA 130 CG32077-PA 1..123 1..110 276 53.7 Plus
CG33267-PB 94 CG33267-PB 18..91 27..104 137 37.2 Plus