BO31371.complete Sequence
286 bp assembled on 2012-03-26
GenBank Submission: KX798187
> BO31371.complete
GAAGTTATCAGTCGACATGAGGCTGCATCTTATACCACTGGTTGGACTCC
TTGCACTGATTATGGCCCAATCCCAAGTACTCCTACCGGGACTTCGCGTG
CGACAGGTTCCCGTGCTCGAAATGGGCCAGATTCCAGTGGTGCAGTACCT
GGACGCGGCCTCCACAGTCACTCCAGAGCTGGTAAAGGATCAGTTCAGCA
GGCGATTCACTACGCTGGCCAAACCCTTGGTCAGTGGTGCTGCTCCCCAA
ACCAGTCTCCCAAATTTGGCAAGCTTTCTAGACCAT
BO31371.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:14:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14664-RC | 255 | CG14664-PC | 1..252 | 17..268 | 1260 | 100 | Plus |
CG14664-RB | 255 | CG14664-PB | 1..252 | 17..268 | 1260 | 100 | Plus |
CG14664-RA | 255 | CG14664-PA | 1..252 | 17..268 | 1260 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:14:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14664-RC | 1404 | CG14664-RC | 17..268 | 17..268 | 1260 | 100 | Plus |
CG14664-RB | 360 | CG14664-RB | 17..268 | 17..268 | 1260 | 100 | Plus |
CG14664-RA | 632 | CG14664-RA | 17..268 | 17..268 | 1260 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:14:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 5224155..5224406 | 17..268 | 1260 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:14:09 has no hits.
BO31371.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:15 Download gff for
BO31371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14664-RA | 17..268 | 17..270 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:54 Download gff for
BO31371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14664-RA | 17..268 | 17..270 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:14 Download gff for
BO31371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14664-RA | 17..268 | 17..270 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:14 Download gff for
BO31371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5224155..5224406 | 17..270 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:54 Download gff for
BO31371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 1049877..1050128 | 17..270 | 99 | | Plus |
BO31371.pep Sequence
Translation from 16 to 286
> BO31371.pep
MRLHLIPLVGLLALIMAQSQVLLPGLRVRQVPVLEMGQIPVVQYLDAAST
VTPELVKDQFSRRFTTLAKPLVSGAAPQTSLPNLASFLDH
BO31371.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14664-PC | 84 | CG14664-PC | 1..84 | 1..84 | 409 | 100 | Plus |
CG14664-PB | 84 | CG14664-PB | 1..84 | 1..84 | 409 | 100 | Plus |
CG14664-PA | 84 | CG14664-PA | 1..84 | 1..84 | 409 | 100 | Plus |