Clone BO31371 Report

Search the DGRC for BO31371

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG14664-RA
Protein status:BO31371.pep: Imported from assembly
Sequenced Size:286

Clone Sequence Records

BO31371.complete Sequence

286 bp assembled on 2012-03-26

GenBank Submission: KX798187

> BO31371.complete
GAAGTTATCAGTCGACATGAGGCTGCATCTTATACCACTGGTTGGACTCC
TTGCACTGATTATGGCCCAATCCCAAGTACTCCTACCGGGACTTCGCGTG
CGACAGGTTCCCGTGCTCGAAATGGGCCAGATTCCAGTGGTGCAGTACCT
GGACGCGGCCTCCACAGTCACTCCAGAGCTGGTAAAGGATCAGTTCAGCA
GGCGATTCACTACGCTGGCCAAACCCTTGGTCAGTGGTGCTGCTCCCCAA
ACCAGTCTCCCAAATTTGGCAAGCTTTCTAGACCAT

BO31371.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14664-RC 255 CG14664-PC 1..252 17..268 1260 100 Plus
CG14664-RB 255 CG14664-PB 1..252 17..268 1260 100 Plus
CG14664-RA 255 CG14664-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14664-RC 1404 CG14664-RC 17..268 17..268 1260 100 Plus
CG14664-RB 360 CG14664-RB 17..268 17..268 1260 100 Plus
CG14664-RA 632 CG14664-RA 17..268 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5224155..5224406 17..268 1260 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:14:09 has no hits.

BO31371.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:15 Download gff for BO31371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14664-RA 17..268 17..270 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:13:54 Download gff for BO31371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14664-RA 17..268 17..270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:14 Download gff for BO31371.complete
Subject Subject Range Query Range Percent Splice Strand
CG14664-RA 17..268 17..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:14 Download gff for BO31371.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5224155..5224406 17..270 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:13:54 Download gff for BO31371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1049877..1050128 17..270 99   Plus

BO31371.pep Sequence

Translation from 16 to 286

> BO31371.pep
MRLHLIPLVGLLALIMAQSQVLLPGLRVRQVPVLEMGQIPVVQYLDAAST
VTPELVKDQFSRRFTTLAKPLVSGAAPQTSLPNLASFLDH

BO31371.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14664-PC 84 CG14664-PC 1..84 1..84 409 100 Plus
CG14664-PB 84 CG14664-PB 1..84 1..84 409 100 Plus
CG14664-PA 84 CG14664-PA 1..84 1..84 409 100 Plus