BO31373.complete Sequence
325 bp assembled on 2012-03-26
GenBank Submission: KX797155
> BO31373.complete
GAAGTTATCAGTCGACATGAACTCGCTCATTGTAATTTTTGGATTTCTTT
TTATCTCAACTCAGATAGTCGCAACAACCGAGTCGGAATGTCCTGAAATC
TGTCTTGCAATTTACAGTCCGGTCTGTGAAGAAGCTATGATAAATGGAAA
ATTGGTTAGATGCTTATTCAGTAATAGCTGCGAAGCAGGTCGTAGCGCAT
GTCTTCATGAAATAAATTGGCGCCAAAAAGAAGGAAAATGTGAAACTTCA
CCCGACCACTTATGCCGTCAATACCTTTCATCTAAAAATATTACTTCAAA
AGTAAGCGCAAGCTTTCTAGACCAT
BO31373.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:14:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42798-RA | 294 | CG42798-PA | 1..291 | 17..307 | 1455 | 100 | Plus |
| CG42798-RB | 174 | CG42798-PB | 1..171 | 137..307 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:14:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42798-RA | 500 | CG42798-RA | 18..308 | 17..307 | 1455 | 100 | Plus |
| CG42798-RB | 527 | CG42798-RB | 92..335 | 64..307 | 1220 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:14:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 17407001..17407199 | 17..215 | 995 | 100 | Plus |
| 3R | 32079331 | 3R | 17407251..17407342 | 216..307 | 460 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:14:39 has no hits.
BO31373.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:20 Download gff for
BO31373.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42798-RA | 18..308 | 17..309 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:11 Download gff for
BO31373.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42798-RA | 18..308 | 17..309 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:28 Download gff for
BO31373.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42798-RA | 18..308 | 17..309 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:28 Download gff for
BO31373.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 17407001..17407199 | 17..215 | 100 | -> | Plus |
| 3R | 17407251..17407342 | 216..309 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:11 Download gff for
BO31373.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 13232723..13232921 | 17..215 | 100 | -> | Plus |
| arm_3R | 13232973..13233064 | 216..309 | 97 | | Plus |
BO31373.pep Sequence
Translation from 16 to 325
> BO31373.pep
MNSLIVIFGFLFISTQIVATTESECPEICLAIYSPVCEEAMINGKLVRCL
FSNSCEAGRSACLHEINWRQKEGKCETSPDHLCRQYLSSKNITSKVSASF
LDH
BO31373.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42798-PA | 97 | CG42798-PA | 1..97 | 1..97 | 514 | 100 | Plus |
| CG42798-PB | 57 | CG42798-PB | 1..57 | 41..97 | 310 | 100 | Plus |
