Clone BO31378 Report

Search the DGRC for BO31378

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG42659-RB
Protein status:BO31378.pep: Imported from assembly
Sequenced Size:181

Clone Sequence Records

BO31378.complete Sequence

181 bp assembled on 2012-03-26

GenBank Submission: KX798949

> BO31378.complete
GAAGTTATCAGTCGACATGGTTTACTTAAGTCGTCCTTGGACTCCGGCCA
TAAACCCTTTCTACATTGGCCCCTATCCGAGATGCGCAGTATGTCCGTGC
AACTTCGACATTTACAAAGGATACACCCCCGGTGGCTGGCACAGTCGTTG
CTATAGCAGCTATGCAAGCTTTCTAGACCAT

BO31378.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-RB 150 CG42659-PB 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-RB 429 CG42659-RB 155..301 17..163 735 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007568..18007714 17..163 735 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:14:51 has no hits.

BO31378.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:22 Download gff for BO31378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 155..301 17..165 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:18 Download gff for BO31378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 155..301 17..165 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:33 Download gff for BO31378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 155..301 17..165 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:33 Download gff for BO31378.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007568..18007714 17..165 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:18 Download gff for BO31378.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18007568..18007714 17..165 98   Plus

BO31378.pep Sequence

Translation from 16 to 181

> BO31378.pep
MVYLSRPWTPAINPFYIGPYPRCAVCPCNFDIYKGYTPGGWHSRCYSSYA
SFLDH

BO31378.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-PB 49 CG42659-PB 1..49 1..49 301 100 Plus