BO31378.complete Sequence
181 bp assembled on 2012-03-26
GenBank Submission: KX798949
> BO31378.complete
GAAGTTATCAGTCGACATGGTTTACTTAAGTCGTCCTTGGACTCCGGCCA
TAAACCCTTTCTACATTGGCCCCTATCCGAGATGCGCAGTATGTCCGTGC
AACTTCGACATTTACAAAGGATACACCCCCGGTGGCTGGCACAGTCGTTG
CTATAGCAGCTATGCAAGCTTTCTAGACCAT
BO31378.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:14:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-RB | 150 | CG42659-PB | 1..147 | 17..163 | 735 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:14:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-RB | 429 | CG42659-RB | 155..301 | 17..163 | 735 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:14:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18007568..18007714 | 17..163 | 735 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:14:51 has no hits.
BO31378.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:22 Download gff for
BO31378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 155..301 | 17..165 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:18 Download gff for
BO31378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 155..301 | 17..165 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:33 Download gff for
BO31378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 155..301 | 17..165 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:33 Download gff for
BO31378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18007568..18007714 | 17..165 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:18 Download gff for
BO31378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18007568..18007714 | 17..165 | 98 | | Plus |
BO31378.pep Sequence
Translation from 16 to 181
> BO31378.pep
MVYLSRPWTPAINPFYIGPYPRCAVCPCNFDIYKGYTPGGWHSRCYSSYA
SFLDH
BO31378.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-PB | 49 | CG42659-PB | 1..49 | 1..49 | 301 | 100 | Plus |