Clone BO31385 Report

Search the DGRC for BO31385

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG13862-RA
Protein status:BO31385.pep: Imported from assembly
Sequenced Size:400

Clone Sequence Records

BO31385.complete Sequence

400 bp assembled on 2012-05-15

GenBank Submission: KX797740

> BO31385.complete
GAAGTTATCAGTCGACATGAAGACGATTTCGCTGCTAACTTTTGTGGTGA
TGATGCTCGGAGTGGCACTGAGCTTGGTTTGGGCCGGCCCCGATGATGGC
TACCTTTATGACCAGCCATCGGGTGAGCAACTTCAGGAACTCCAGGTGAT
CTCTCCCCCCAGGAAGCTCCGGCTAAAGCCACGTGTCTACCCAGGGCATC
CCTCTCAGGCTTGCGGAAACGTGGAGGCGACGGATCATGCCGCTGCCCTG
ACCACCTACCATGCCAACCGCCCCCAGCCGCGTCGCATTTACAATCACCA
GGAAGTCGAGGTGGACAGCTCGTTCTTTGAGCCCACGCCGGATCGGATCG
AGGAACTCAAGCGTATTCTCTTGGATCAGCAAGCAAGCTTTCTAGACCAT

BO31385.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13862-RA 336 CG13862-PA 1..333 50..382 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13862-RA 490 CG13862-RA 59..425 16..382 1835 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22332158..22332494 46..382 1685 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:20:58 has no hits.

BO31385.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-15 14:08:15 Download gff for BO31385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 60..425 17..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:20:29 Download gff for BO31385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 60..425 17..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:41:02 Download gff for BO31385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 60..425 17..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:41:02 Download gff for BO31385.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22332050..22332079 17..46 100 -> Plus
3R 22332159..22332494 47..384 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:20:29 Download gff for BO31385.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18157772..18157801 17..46 100 -> Plus
arm_3R 18157881..18158216 47..384 99   Plus

BO31385.pep Sequence

Translation from 16 to 400

> BO31385.pep
MKTISLLTFVVMMLGVALSLVWAGPDDGYLYDQPSGEQLQELQVISPPRK
LRLKPRVYPGHPSQACGNVEATDHAAALTTYHANRPQPRRIYNHQEVEVD
SSFFEPTPDRIEELKRILLDQQASFLDH

BO31385.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13862-PA 111 CG13862-PA 1..111 12..122 590 100 Plus