Clone BO31389 Report

Search the DGRC for BO31389

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:313
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG13000-RA
Protein status:BO31389.pep: Imported from assembly
Sequenced Size:364

Clone Sequence Records

BO31389.complete Sequence

364 bp assembled on 2012-03-26

GenBank Submission: KX795961

> BO31389.complete
GAAGTTATCAGTCGACATGTCCATTAGCCTCTCTGAATTCTACCAATCCT
CACTGACTTTCTGGAGCCATCTGATCCATATACTGCTGCAGTTCATCCAG
ACCAACTGCTGGAATCACATCACACAGAAGGAGCAGCAGCAAGAGGAACT
CAACGAACCCTGTGCCATCTCAAAAACCATGGACGCCTTCGTGGAGGAGC
AGCAAAAGCGGGTGCAACGAAAATCCCACGAGTACGCCAAAGTGGAGCTA
CTGCATCGCCTGCTTGTCCAGCAGCAACTGCAGGAACTGGAGCAGCGCCG
ACTCATCCGATTGGCTCTGGCCAGGAGGCGACTGGACTACTCCAATGCAA
GCTTTCTAGACCAT

BO31389.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13000-RA 333 CG13000-PA 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13000-RA 508 CG13000-RA 27..361 12..346 1675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16948111..16948445 346..12 1675 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:15:07 has no hits.

BO31389.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:25 Download gff for BO31389.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 1..330 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:27 Download gff for BO31389.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 32..361 17..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:40 Download gff for BO31389.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 32..361 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:40 Download gff for BO31389.complete
Subject Subject Range Query Range Percent Splice Strand
X 16948109..16948440 17..348 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:27 Download gff for BO31389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16842142..16842473 17..348 99   Minus

BO31389.pep Sequence

Translation from 16 to 364

> BO31389.pep
MSISLSEFYQSSLTFWSHLIHILLQFIQTNCWNHITQKEQQQEELNEPCA
ISKTMDAFVEEQQKRVQRKSHEYAKVELLHRLLVQQQLQELEQRRLIRLA
LARRRLDYSNASFLDH

BO31389.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13000-PA 110 CG13000-PA 1..110 1..110 562 100 Plus