BO31390.complete Sequence
328 bp assembled on 2012-03-26
GenBank Submission: KX796524
> BO31390.complete
GAAGTTATCAGTCGACATGCCTTCCGTCGAGTGGGTCTGTGGTTTGCTCT
ACTACGTTATGCGCACCTACATAAAGGTATTCGTATCCAGTTGCGAAGCA
CACTTCCCTATCGATATCCTTGACAAGATTGTGTATTTGATAGATTTCGC
CGAAGTTTCCATGAAGATAATGCGCCGGCCAAGAAATTACACGAATCCGA
CTGAGCGCCAAGCGAGACGCCTTCAATTCTACAATTTCCTTTTAAAGTTA
AGATTTTTGGCACAGGTGATCTACACCTTGGTAGCCGTGGTAATTGGGAC
ACTTAAAACAGCAAGCTTTCTAGACCAT
BO31390.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:15:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42766-RB | 297 | CG42766-PB | 1..294 | 17..310 | 1470 | 100 | Plus |
CG42766-RA | 297 | CG42766-PA | 1..273 | 17..289 | 1365 | 100 | Plus |
CG43076-RA | 483 | CG43076-PA | 11..273 | 27..289 | 325 | 74.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:15:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42766-RB | 732 | CG42766-RB | 111..409 | 12..310 | 1480 | 99.7 | Plus |
CG42766-RA | 626 | CG42766-RA | 111..388 | 12..289 | 1375 | 99.6 | Plus |
CG43076-RA | 771 | CG43076-RA | 110..372 | 27..289 | 325 | 74.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:15:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 15977153..15977337 | 126..310 | 925 | 100 | Plus |
X | 23542271 | X | 15976978..15977093 | 12..127 | 565 | 99.1 | Plus |
X | 23542271 | X | 15223143..15223286 | 295..152 | 210 | 76.4 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:15:10 has no hits.
BO31390.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:25 Download gff for
BO31390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42766-RB | 116..409 | 17..312 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:29 Download gff for
BO31390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42766-RB | 116..409 | 17..312 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:43 Download gff for
BO31390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42766-RB | 116..409 | 17..312 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:43 Download gff for
BO31390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 15976983..15977093 | 17..127 | 100 | -> | Plus |
X | 15977155..15977337 | 128..312 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:29 Download gff for
BO31390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 15871016..15871126 | 17..127 | 100 | -> | Plus |
arm_X | 15871188..15871370 | 128..312 | 98 | | Plus |
BO31390.pep Sequence
Translation from 16 to 328
> BO31390.pep
MPSVEWVCGLLYYVMRTYIKVFVSSCEAHFPIDILDKIVYLIDFAEVSMK
IMRRPRNYTNPTERQARRLQFYNFLLKLRFLAQVIYTLVAVVIGTLKTAS
FLDH
BO31390.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42766-PB | 98 | CG42766-PB | 1..98 | 1..98 | 504 | 100 | Plus |
CG42766-PA | 98 | CG42766-PA | 1..92 | 1..92 | 472 | 98.9 | Plus |
CG43076-PA | 160 | CG43076-PA | 1..92 | 1..92 | 223 | 50 | Plus |