Clone BO31409 Report

Search the DGRC for BO31409

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:314
Well:9
Vector:pDNR-Dual
Associated Gene/Transcripthalo-RB
Protein status:BO31409.pep: Imported from assembly
Sequenced Size:361

Clone Sequence Records

BO31409.complete Sequence

361 bp assembled on 2012-04-24

GenBank Submission: KX795427

> BO31409.complete
GAAGTTATCAGTCGACATGGCCGAGCTACTTTTTCCACAACTGGAGCGTC
CTTTGCCCTCGCTGCCATCGCTGCACTACACCCTGTTTGCCTACAGGGAG
GAGTTGCGACGCCGCGATGCCCCGTTCATGAAGATGTCCACCATCAAGCT
GCATCTCACGGACAACCTCATCCTGCAGACGATCAAGAACATCCGGCAGT
ATGACACCATCGAGATTATGAATCTCAACCAGGAGATAAACTTCAAGCGG
CGGCTGACCAAACAAATGAGGAAGGTGCGCAAACTGGAGAAGCTCGGCTT
GCACATCGATCCCCGGAAACTCAACGAGGACGGCAAATGGCACGCAAGCT
TTCTAGACCAT

BO31409.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
halo-RB 330 CG7428-PB 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
halo-RB 616 CG7428-RB 88..414 17..343 1635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1517735..1518061 343..17 1635 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:17:19 has no hits.

BO31409.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:02:03 Download gff for BO31409.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RA 124..450 17..345 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:05 Download gff for BO31409.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 88..414 17..345 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:46 Download gff for BO31409.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 88..414 17..345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:46 Download gff for BO31409.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1517732..1518061 17..345 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:05 Download gff for BO31409.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1517732..1518061 17..345 99   Minus

BO31409.pep Sequence

Translation from 16 to 361

> BO31409.pep
MAELLFPQLERPLPSLPSLHYTLFAYREELRRRDAPFMKMSTIKLHLTDN
LILQTIKNIRQYDTIEIMNLNQEINFKRRLTKQMRKVRKLEKLGLHIDPR
KLNEDGKWHASFLDH

BO31409.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
halo-PB 109 CG7428-PB 1..109 1..109 565 100 Plus
CG13711-PA 127 CG13711-PA 37..115 17..95 165 32.9 Plus
CG13713-PA 99 CG13713-PA 9..81 17..89 143 37 Plus
CG13716-PA 117 CG13716-PA 24..94 14..84 135 40.8 Plus