Clone BO31418 Report

Search the DGRC for BO31418

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:314
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptHSPC300-RA
Protein status:BO31418.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO31418.complete Sequence

262 bp assembled on 2012-03-26

GenBank Submission: KX794530

> BO31418.complete
GAAGTTATCAGTCGACATGAGTGGGGCTCACAGAGAGGCGATCCAAAAGC
AGATCCACCAGGACTGGGCGAACAGGGAGTATATCGAAGTGATAACTGCC
AGCATAAAGAGAATCACCGACTTTCTGAACTCTTTCGATATGTCCTGTCG
CTCCCGTCTGGCGGTGCTGAACGAAAAACTAACGATCCTGGAGCGGCGCA
TAGACTATCTGGAGGCGTGCGTCGCCCAGGGTGAAACATTAACGGCAAGC
TTTCTAGACCAT

BO31418.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-RB 231 CG30173-PB 1..228 17..244 1140 100 Plus
HSPC300-RA 231 CG30173-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-RB 584 CG30173-RB 56..283 17..244 1140 100 Plus
HSPC300-RA 349 CG30173-RA 56..283 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24028614..24028734 137..17 605 100 Minus
2R 25286936 2R 24028018..24028125 244..137 540 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:15:26 has no hits.

BO31418.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:28 Download gff for BO31418.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 69..296 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:37 Download gff for BO31418.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 56..283 17..246 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:50 Download gff for BO31418.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 56..283 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:50 Download gff for BO31418.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24028016..24028124 138..246 98 <- Minus
2R 24028614..24028734 17..137 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:37 Download gff for BO31418.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19915539..19915647 138..246 98 <- Minus
arm_2R 19916137..19916257 17..137 100   Minus

BO31418.pep Sequence

Translation from 16 to 262

> BO31418.pep
MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAV
LNEKLTILERRIDYLEACVAQGETLTASFLDH

BO31418.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-PB 76 CG30173-PB 1..76 1..76 385 100 Plus
HSPC300-PA 76 CG30173-PA 1..76 1..76 385 100 Plus