BO31418.complete Sequence
262 bp assembled on 2012-03-26
GenBank Submission: KX794530
> BO31418.complete
GAAGTTATCAGTCGACATGAGTGGGGCTCACAGAGAGGCGATCCAAAAGC
AGATCCACCAGGACTGGGCGAACAGGGAGTATATCGAAGTGATAACTGCC
AGCATAAAGAGAATCACCGACTTTCTGAACTCTTTCGATATGTCCTGTCG
CTCCCGTCTGGCGGTGCTGAACGAAAAACTAACGATCCTGGAGCGGCGCA
TAGACTATCTGGAGGCGTGCGTCGCCCAGGGTGAAACATTAACGGCAAGC
TTTCTAGACCAT
BO31418.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:15:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HSPC300-RB | 231 | CG30173-PB | 1..228 | 17..244 | 1140 | 100 | Plus |
HSPC300-RA | 231 | CG30173-PA | 1..228 | 17..244 | 1140 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:15:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HSPC300-RB | 584 | CG30173-RB | 56..283 | 17..244 | 1140 | 100 | Plus |
HSPC300-RA | 349 | CG30173-RA | 56..283 | 17..244 | 1140 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:15:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24028614..24028734 | 137..17 | 605 | 100 | Minus |
2R | 25286936 | 2R | 24028018..24028125 | 244..137 | 540 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:15:26 has no hits.
BO31418.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:28 Download gff for
BO31418.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
HSPC300-RA | 69..296 | 17..246 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:37 Download gff for
BO31418.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
HSPC300-RA | 56..283 | 17..246 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:50 Download gff for
BO31418.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
HSPC300-RA | 56..283 | 17..246 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:50 Download gff for
BO31418.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24028016..24028124 | 138..246 | 98 | <- | Minus |
2R | 24028614..24028734 | 17..137 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:37 Download gff for
BO31418.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19915539..19915647 | 138..246 | 98 | <- | Minus |
arm_2R | 19916137..19916257 | 17..137 | 100 | | Minus |
BO31418.pep Sequence
Translation from 16 to 262
> BO31418.pep
MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAV
LNEKLTILERRIDYLEACVAQGETLTASFLDH
BO31418.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HSPC300-PB | 76 | CG30173-PB | 1..76 | 1..76 | 385 | 100 | Plus |
HSPC300-PA | 76 | CG30173-PA | 1..76 | 1..76 | 385 | 100 | Plus |