Clone BO31426 Report

Search the DGRC for BO31426

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:314
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG42512-RA
Protein status:BO31426.pep: Imported from assembly
Sequenced Size:362

Clone Sequence Records

BO31426.complete Sequence

362 bp assembled on 2012-03-26

GenBank Submission: KX794665

> BO31426.complete
GAAGTTATCAGTCGACATGGAGAACAAAAAATGATATAAAAGAAATGGAC
CTGGGCCTATCTCGAGCAGATATGTTGGAACAGCTCGAAAAAAGGCGAAT
ATTTCTGGGCGATGGCAAGGATATGCCGCTGGATCGTCTGGAGGATATCT
ACCGCAATTACATAGTTCCCAAGCCAAAAAGAGAGCGCAAGCCGCGCAAT
CCAAGTCCCGATCCCAATTTCAATCCCATTGAAATAGAGCAGCTAGCGGA
GCGCATCAAGTCGGTTGTCATAGTGGGACAGAAACGAGCGCATGCAGAGA
ATAAGAGCGACGACCAGGCCAAGCAAATCAAGATGGACCTGGACGCAAGC
TTTCTAGACCAT

BO31426.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42512-RB 303 CG42512-PB 1..300 45..344 1500 100 Plus
CG42512-RA 303 CG42512-PA 1..300 45..344 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42512-RB 617 CG42512-RB 90..407 27..344 1590 100 Plus
CG42512-RA 1782 CG42512-RA 90..407 27..344 1590 100 Plus
CG32573-RA 1782 CG32573-RA 90..407 27..344 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16651587..16651838 93..344 1260 100 Plus
X 23542271 X 16651465..16651530 27..92 330 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:15:31 has no hits.

BO31426.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:29 Download gff for BO31426.complete
Subject Subject Range Query Range Percent Splice Strand
CG32573-RA 81..407 17..346 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:39 Download gff for BO31426.complete
Subject Subject Range Query Range Percent Splice Strand
CG32573-RA 81..407 17..346 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:52 Download gff for BO31426.complete
Subject Subject Range Query Range Percent Splice Strand
CG32573-RA 81..407 17..346 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:52 Download gff for BO31426.complete
Subject Subject Range Query Range Percent Splice Strand
X 16651456..16651530 17..92 98 -> Plus
X 16651587..16651838 93..346 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:39 Download gff for BO31426.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16545489..16545563 17..92 98 -> Plus
arm_X 16545620..16545871 93..346 99   Plus

BO31426.pep Sequence

Translation from 44 to 362

> BO31426.pep
MDLGLSRADMLEQLEKRRIFLGDGKDMPLDRLEDIYRNYIVPKPKRERKP
RNPSPDPNFNPIEIEQLAERIKSVVIVGQKRAHAENKSDDQAKQIKMDLD
ASFLDH

BO31426.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42512-PB 100 CG42512-PB 1..100 1..100 515 100 Plus
CG42512-PA 100 CG42512-PA 1..100 1..100 515 100 Plus