Clone BO31440 Report

Search the DGRC for BO31440

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:314
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG13445-RA
Protein status:BO31440.pep: Imported from assembly
Sequenced Size:355

Clone Sequence Records

BO31440.complete Sequence

355 bp assembled on 2012-03-26

GenBank Submission: KX799031

> BO31440.complete
GAAGTTATCAGTCGACATGCAGTCTAACAAGGTTTTCTTCGTGTTCTTTG
GTATCATCGCCATGGTGATCGCCGCCAGTCTCTCCTCGGATGTTGTGGAC
AAGGGTGATGATGTGATCAGCGATCGTCGTTTCCGTTGGGAATTCTCGCA
GGACTCGGATGAGTCTGCCAACGACTTGCAGGAGGATGATGATGATGATG
ACGATGCCGCGGATGATGACAGCGGCAGTGCATCCGAAGAAATTTTGATC
ATCGAGTATCCTGAAGGCTACGAAAGCGGCTCCAATGAAAGCGCCTCCGA
TGAAAGCGTCTCCGATGAAAGCGCCTCCAATGAATCTGCAAGCTTTCTAG
ACCAT

BO31440.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13445-RA 324 CG13445-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13445-RA 431 CG13445-RA 14..334 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15809593..15809880 50..337 1440 100 Plus
3L 28110227 3L 15809498..15809533 17..52 180 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:15:40 has no hits.

BO31440.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:30 Download gff for BO31440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 1..321 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:41 Download gff for BO31440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 14..334 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:23:55 Download gff for BO31440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 14..334 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:23:55 Download gff for BO31440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15809498..15809531 17..50 100 -> Plus
3L 15809594..15809880 51..339 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:41 Download gff for BO31440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15802598..15802631 17..50 100 -> Plus
arm_3L 15802694..15802980 51..339 99   Plus

BO31440.pep Sequence

Translation from 16 to 355

> BO31440.pep
MQSNKVFFVFFGIIAMVIAASLSSDVVDKGDDVISDRRFRWEFSQDSDES
ANDLQEDDDDDDDAADDDSGSASEEILIIEYPEGYESGSNESASDESVSD
ESASNESASFLDH

BO31440.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13445-PA 107 CG13445-PA 1..107 1..107 536 100 Plus