Clone BO31512 Report

Search the DGRC for BO31512

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:315
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG32582-RB
Protein status:BO31512.pep: Imported from assembly
Sequenced Size:283

Clone Sequence Records

BO31512.complete Sequence

283 bp assembled on 2012-04-18

GenBank Submission: KX797153

> BO31512.complete
GAAGTTATCAGTCGACATGGGGCAAGGAGCTAGACGAATATTGCGGGCGT
CCCGCTCGCAGATTTGCGGTAGTCTTCGAACGGGCGAAGGGTCCAGCACC
TCAGCAAGTTGTCGAAAAGTGGTAAAAAACCCAGCTGGATTGTCCGAATT
TGACCAGTGCTCGATGCTTTGGCCGTTCGCAGTCTGCCGCATTCCTGCTA
GGCGTCCCACCCGCCCAGGATTCCTCAACCCAGGGCCATTGGGAGAGGAT
CCGTCGCTAACAGAAGCAAGCTTTCTAGACCAT

BO31512.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 05:00:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp47-RB 1285 CG8928-RB 1132..1189 112..55 230 93.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15836523..15836670 118..265 740 100 Plus
X 23542271 X 15836295..15836397 17..119 515 100 Plus
X 23542271 X 15946096..15946153 112..55 230 93.1 Minus
Blast to na_te.dros performed on 2014-11-28 05:00:20 has no hits.

BO31512.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-18 21:42:28 Download gff for BO31512.complete
Subject Subject Range Query Range Percent Splice Strand
CG32582-RB 130..378 17..267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:21:26 Download gff for BO31512.complete
Subject Subject Range Query Range Percent Splice Strand
CG32582-RB 108..356 17..267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:41:44 Download gff for BO31512.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp47-RB 1252..1270 17..35 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:41:44 Download gff for BO31512.complete
Subject Subject Range Query Range Percent Splice Strand
X 15836295..15836397 17..119 100 -> Plus
X 15836525..15836670 120..267 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:21:26 Download gff for BO31512.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15730558..15730703 120..267 98   Plus
arm_X 15730328..15730430 17..119 100 -> Plus

BO31512.pep Sequence

Translation from 16 to 283

> BO31512.pep
MGQGARRILRASRSQICGSLRTGEGSSTSASCRKVVKNPAGLSEFDQCSM
LWPFAVCRIPARRPTRPGFLNPGPLGEDPSLTEASFLDH
Sequence BO31512.pep has no blast hits.