Clone BO31513 Report

Search the DGRC for BO31513

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:315
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG14397-RA
Protein status:BO31513.pep: Imported from assembly
Sequenced Size:355

Clone Sequence Records

BO31513.complete Sequence

355 bp assembled on 2012-04-18

GenBank Submission: KX797695

> BO31513.complete
GAAGTTATCAGTCGACATGTGCCTCCTGCCCGGTCGCTTCTTCTGGTCAG
CTTTCATTGTGACGATGGTGGGTCTATCCGCAACGATCGAAGCTAGACCC
CAGAGGAATCTGCAGCACATCGCCGTGGTGGAGAATGCCGCCTGGGAAAA
GACCCTTCCGCAGCAGTTCCAGAACCCCTTCTACAATACCCCAAGGGTGA
GAGATGCCCTGGCCAGATCCAGTTGGTTTGGACCCGGCGAGGAGGTGGTT
TATGACCGCCAGGCTGAAAAAATTCCTCGCATGGAAATCTACAATGTGTT
GTCTCATGCTGGTTTGATACCACGCCGGCGTTTTCTTGCAAGCTTTCTAG
ACCAT

BO31513.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-RA 324 CG14397-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-RA 533 CG14397-RA 141..461 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21094409..21094639 19..249 1155 100 Plus
2L 23513712 2L 21094702..21094792 247..337 455 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:03:10 has no hits.

BO31513.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-18 21:42:38 Download gff for BO31513.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 127..447 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:21:48 Download gff for BO31513.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 141..461 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:42:45 Download gff for BO31513.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 141..461 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:42:45 Download gff for BO31513.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21094407..21094637 17..247 99 -> Plus
2L 21094703..21094792 248..339 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:21:48 Download gff for BO31513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21094407..21094637 17..247 99 -> Plus
arm_2L 21094703..21094792 248..339 97   Plus

BO31513.pep Sequence

Translation from 16 to 355

> BO31513.pep
MCLLPGRFFWSAFIVTMVGLSATIEARPQRNLQHIAVVENAAWEKTLPQQ
FQNPFYNTPRVRDALARSSWFGPGEEVVYDRQAEKIPRMEIYNVLSHAGL
IPRRRFLASFLDH

BO31513.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-PA 107 CG14397-PA 1..107 1..107 566 100 Plus