Clone BO31533 Report

Search the DGRC for BO31533

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:315
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptArpc3A-RC
Protein status:BO31533.pep: Imported from assembly
Sequenced Size:565

Clone Sequence Records

BO31533.complete Sequence

565 bp assembled on 2012-04-18

GenBank Submission: KX799722

> BO31533.complete
GAAGTTATCAGTCGACATGCCGGCCTACCACTCGCAGATCAAGGAAGTGC
GCCAGCAGGTGGGCAACATGGCCATCCTGCCGCTGAGGACGCAGGTGCGC
GGGCCAGCGCCCAGTGCGAATATTGAGAGCGACATCATTGATGAGTCACT
GTACTACTTCAAAGCCAATGTCTTCTTTCGCACGTACGAAATCAAGTCCG
ACGTGGATCGCGTGCTCATCTATGTGACGCTCTACATAACAGAGTGCCTC
AAGAAGCTCAATCGCTCCACGAGCAAGGCCCAGGGACAGCAGGACATGTA
CAGCCTGGCCATCTCCAAGTTCGACATTCCCGGCGATGCTGGCTTCCCAT
TGAACGCCGTCTATGCCAAGCCGCAAACGGCCCAGGATGCGGATCTGATG
CGCCAGTACCTGCTGCAGCTGCGCCACGAAACCGGCAACCGGGTACTGGA
GAAGGTCTTCAACACCGAGGATGGCAAGCCCAATAAATGGTGGACCTGCT
TCGCGAAGAAAAAGTTCATGGAGAAGAGTCTGGCTGGACCTGGACAAGCA
AGCTTTCTAGACCAT

BO31533.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-RE 534 CG4560-PE 1..531 17..547 2655 100 Plus
Arpc3A-RC 534 CG4560-PC 1..531 17..547 2655 100 Plus
Arpc3B-RA 525 CG8936-PA 42..519 58..544 435 73.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-RE 1123 CG4560-RE 117..649 15..547 2665 100 Plus
Arpc3A-RC 814 CG4560-RC 117..649 15..547 2665 100 Plus
Arpc3B-RC 693 CG8936-RC 139..616 58..544 435 73.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15835195..15835547 195..547 1765 100 Plus
3R 32079331 3R 15834912..15835086 22..196 875 100 Plus
X 23542271 X 17104648..17104808 544..384 310 79.5 Minus
Blast to na_te.dros performed on 2014-11-28 05:05:25 has no hits.

BO31533.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-18 21:42:50 Download gff for BO31533.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 119..649 17..549 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:22:11 Download gff for BO31533.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 119..649 17..549 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:43:38 Download gff for BO31533.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 119..649 17..549 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:43:38 Download gff for BO31533.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834907..15835086 17..196 98 -> Plus
3R 15835197..15835547 197..549 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:22:11 Download gff for BO31533.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11660629..11660808 17..196 98 -> Plus
arm_3R 11660919..11661269 197..549 99   Plus

BO31533.pep Sequence

Translation from 16 to 565

> BO31533.pep
MPAYHSQIKEVRQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKA
NVFFRTYEIKSDVDRVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAIS
KFDIPGDAGFPLNAVYAKPQTAQDADLMRQYLLQLRHETGNRVLEKVFNT
EDGKPNKWWTCFAKKKFMEKSLAGPGQASFLDH

BO31533.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-PE 177 CG4560-PE 1..177 1..177 923 100 Plus
Arpc3A-PC 177 CG4560-PC 1..177 1..177 923 100 Plus
Arpc3B-PA 174 CG8936-PA 1..173 1..176 721 73.9 Plus
Arpc3B-PC 157 CG8936-PC 1..156 18..176 666 76.1 Plus
Arpc3B-PB 157 CG8936-PB 1..156 18..176 666 76.1 Plus