Clone BO31536 Report

Search the DGRC for BO31536

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:315
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG14036-RA
Protein status:BO31536.pep: Imported from assembly
Sequenced Size:313

Clone Sequence Records

BO31536.complete Sequence

313 bp assembled on 2012-04-18

GenBank Submission: KX795026

> BO31536.complete
GAAGTTATCAGTCGACATGTCCGATTTCGAGTACGGAATTTGCCCTTACG
ACAAATCGCACCGCATCTTGCTCTTCCGGATGCCCAAGCACTTAATTAAG
TGCGAGAAGAACTACTGTGGACCGCCGCTGCAGACCTGCAAGTACAACGC
CACACACCGAGTCCAGGACATGGAGAAGCATCTGAAGGAGTGTGACTACT
ATCTCCGCAGCATCGAAAACCAGGCGGTGCAGATAGCGCTTCGTAGTCGC
ATACCGCCCAAACAGGAAGATGGACATGATGTGGACACACCATTTGCAAG
CTTTCTAGACCAT

BO31536.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-RA 282 CG14036-PA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-RA 438 CG14036-RA 65..343 17..295 1395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5054674..5054952 295..17 1395 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:04:07 has no hits.

BO31536.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-18 21:42:44 Download gff for BO31536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 53..331 17..297 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:22:01 Download gff for BO31536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 65..343 17..297 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:43:08 Download gff for BO31536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 65..343 17..297 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:43:08 Download gff for BO31536.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5054672..5054952 17..297 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:22:01 Download gff for BO31536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5054672..5054952 17..297 99   Minus

BO31536.pep Sequence

Translation from 16 to 313

> BO31536.pep
MSDFEYGICPYDKSHRILLFRMPKHLIKCEKNYCGPPLQTCKYNATHRVQ
DMEKHLKECDYYLRSIENQAVQIALRSRIPPKQEDGHDVDTPFASFLDH

BO31536.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-PA 93 CG14036-PA 1..93 1..93 519 100 Plus
CG32625-PA 144 CG32625-PA 8..70 4..64 137 41.3 Plus