Clone BO31616 Report

Search the DGRC for BO31616

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:316
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptTotM-RA
Protein status:BO31616.pep: Imported from assembly
Sequenced Size:427

Clone Sequence Records

BO31616.complete Sequence

427 bp assembled on 2012-04-18

GenBank Submission: KX797306

> BO31616.complete
GAAGTTATCAGTCGACATGAATCCTACAATTTATTTGAGCTGCCTTATGG
TCTTCTCAGTGTTTCTGCTGGGAAAGGTAAATGCTGAGAACGAAGATGAG
TTCGTCACAGAAAAACAGCGCCTATTTAGTGTGTATGGTGATTCTTCGGT
TGATGAGGCCACCAAATACCGGAACATCGACAGCCTGGTCACTTTCTACG
ATAAGTACTTCACTCGACTTCAGTTGAAACCGGACTTGAACACACGCGCC
CATGATCTCTTGAGGCGTTACAAGGAGGAAAATGCTCGTGTGGTCTTGGT
GGACGGTACTCCCGCACAAGGCGGATTCTGGTTGCCACTGGTGAAGCTAC
TCATTGTCCAGCTGGGCGTCGAAATTGCCTCTGAGGGAGTCAAGCGTGCT
ATTGAATCCGCAAGCTTTCTAGACCAT

BO31616.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
TotM-RB 396 CG14027-PB 1..393 17..409 1965 100 Plus
TotM-RA 396 CG14027-PA 1..393 17..409 1965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
TotM-RB 511 CG14027-RB 34..426 17..409 1965 100 Plus
TotM-RA 552 CG14027-RA 34..426 17..409 1965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5329958..5330338 29..409 1875 99.5 Plus
Blast to na_te.dros performed on 2014-11-28 05:11:14 has no hits.

BO31616.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-18 21:43:13 Download gff for BO31616.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 34..426 17..411 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:23:08 Download gff for BO31616.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 34..426 17..411 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:45:29 Download gff for BO31616.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 34..426 17..411 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:45:29 Download gff for BO31616.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5329890..5329912 17..39 100 -> Plus
2L 5329969..5330338 40..411 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:23:08 Download gff for BO31616.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5329890..5329912 17..39 100 -> Plus
arm_2L 5329969..5330338 40..411 99   Plus

BO31616.pep Sequence

Translation from 16 to 427

> BO31616.pep
MNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRLFSVYGDSSVDEATK
YRNIDSLVTFYDKYFTRLQLKPDLNTRAHDLLRRYKEENARVVLVDGTPA
QGGFWLPLVKLLIVQLGVEIASEGVKRAIESASFLDH

BO31616.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
TotM-PB 131 CG14027-PB 1..131 1..131 665 100 Plus
TotM-PA 131 CG14027-PA 1..131 1..131 665 100 Plus
Victoria-PA 134 CG33117-PA 16..126 1..113 204 38.1 Plus
TotF-PA 125 CG31691-PA 6..123 10..129 190 39 Plus