BO32102.complete Sequence
232 bp assembled on 2012-07-09
GenBank Submission: KX798600
> BO32102.complete
GAAGTTATCAGTCGACATGTTGGGCCGCAGCAGTGTGATTGCACGCAACT
TTTCCCAGTCGATGGTTCGCTTTAGCGGACATGGTGGAGTTCCCGGAGAG
AATCTTCCCTTCGGGCTGACGAACAAGTACCGCATCACCGCCCTGTTCAC
CATCGGCTGTGTCTTGGGCTTCGGATCGCCCTTCCTGATCGTCAGGCACC
AACTGCTCAAGAAGGCAAGCTTTCTAGACCAT
BO32102.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:39:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIIc-RD | 201 | CG2249-PD | 1..198 | 17..214 | 990 | 100 | Plus |
| CoVIIc-RC | 201 | CG2249-PC | 1..198 | 17..214 | 990 | 100 | Plus |
| CoVIIc-RB | 201 | CG2249-PB | 1..198 | 17..214 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:39:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIIc-RD | 625 | CG2249-RD | 284..485 | 13..214 | 995 | 99.5 | Plus |
| CoVIIc-RC | 853 | CG2249-RC | 507..708 | 13..214 | 995 | 99.5 | Plus |
| CoVIIc-RB | 418 | CG2249-RB | 77..278 | 13..214 | 995 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:39:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 10049751..10049866 | 99..214 | 580 | 100 | Plus |
| 2R | 25286936 | 2R | 10049557..10049644 | 13..100 | 425 | 98.9 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:39:35 has no hits.
BO32102.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-09 16:49:17 Download gff for
BO32102.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG2249-RA | 87..279 | 22..216 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:23 Download gff for
BO32102.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIIc-RB | 86..278 | 22..216 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:48:42 Download gff for
BO32102.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIIc-RB | 86..278 | 22..216 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:48:42 Download gff for
BO32102.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 10049566..10049644 | 22..100 | 100 | -> | Plus |
| 2R | 10049753..10049866 | 101..216 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:23 Download gff for
BO32102.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 5937071..5937149 | 22..100 | 100 | -> | Plus |
| arm_2R | 5937258..5937371 | 101..216 | 98 | | Plus |
BO32102.pep Sequence
Translation from 16 to 232
> BO32102.pep
MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVL
GFGSPFLIVRHQLLKKASFLDH
BO32102.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:07:13
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIIc-PD | 66 | CG2249-PD | 1..66 | 1..66 | 341 | 100 | Plus |
| CoVIIc-PC | 66 | CG2249-PC | 1..66 | 1..66 | 341 | 100 | Plus |
| CoVIIc-PB | 66 | CG2249-PB | 1..66 | 1..66 | 341 | 100 | Plus |
| CoVIIc-PA | 66 | CG2249-PA | 1..66 | 1..66 | 341 | 100 | Plus |
| CG44296-PA | 76 | CG44296-PA | 12..70 | 12..68 | 145 | 49.2 | Plus |
