Clone BO32301 Report

Search the DGRC for BO32301

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:323
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG13557-RA
Protein status:BO32301.pep: Imported from assembly
Sequenced Size:343

Clone Sequence Records

BO32301.complete Sequence

343 bp assembled on 2012-07-09

GenBank Submission: KX797514

> BO32301.complete
GAAGTTATCAGTCGACATGGTCTCCAAGTGGCTGCGCATCTTGGTTCTAT
TTCTTCTGGGTCTTGCAACCTCGCGGGCCTCCCTATTTCGCTCCGAGTCG
CCGAAACCACAGTTGAGCTGGTGGCACAAACAGTACTACCAGTCGCTATG
GCAACAGAGGCTGCGGTTTACGACGACTCCCCGGCCAGGAGCCACTCCCG
AATCGGATGAAGCCAGATTGGTGTATCCCTGCTACTGCTACAAGCCAACT
CCCGAGGGCTTGGCCACTGCCAGTCCGGTGGAGCAGCGAATGATTGAGAC
CAAGGAAATATTCTTCTTGAACAAAGCAAGCTTTCTAGACCAT

BO32301.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-RA 312 CG13557-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-RA 436 CG13557-RA 10..318 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23475816..23475991 325..150 880 100 Minus
2R 25286936 2R 23476276..23476409 150..17 670 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:39:22 has no hits.

BO32301.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-09 16:49:14 Download gff for BO32301.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 10..318 17..327 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:16 Download gff for BO32301.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 10..318 17..327 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:48:36 Download gff for BO32301.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 10..318 17..327 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:48:36 Download gff for BO32301.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23475814..23475991 150..327 98 <- Minus
2R 23476277..23476409 17..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:16 Download gff for BO32301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19363337..19363514 150..327 98 <- Minus
arm_2R 19363800..19363932 17..149 100   Minus

BO32301.pep Sequence

Translation from 16 to 343

> BO32301.pep
MVSKWLRILVLFLLGLATSRASLFRSESPKPQLSWWHKQYYQSLWQQRLR
FTTTPRPGATPESDEARLVYPCYCYKPTPEGLATASPVEQRMIETKEIFF
LNKASFLDH

BO32301.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-PA 103 CG13557-PA 1..103 1..103 553 100 Plus