BO32302.complete Sequence
223 bp assembled on 2012-07-09
GenBank Submission: KX794833
> BO32302.complete
GAAGTTATCAGTCGACATGAACAGTTCCAAAAACGATGTCCGTTCTTCCT
TTAAATACGGGCCAGCTGTCCGGATCGGAATCGCCGTCCTGGTGCTCCAC
ACCGTCGGCTGGCTGGGTTGGAAGGCGGTGAACCAGGGTGCGGAATCCAA
GGAGGCAGCAGCGAAGGCCCAGCAAGAACAATTGCGAGCGGTATTCGCAG
AAAAGGCAAGCTTTCTAGACCAT
BO32302.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:39:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43107-RA | 192 | CG43107-PA | 1..189 | 17..205 | 945 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:39:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43107-RA | 371 | CG43107-RA | 45..233 | 17..205 | 945 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:39:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17140633..17140821 | 205..17 | 945 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:39:26 has no hits.
BO32302.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-09 16:49:15 Download gff for
BO32302.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 59..247 | 17..207 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:18 Download gff for
BO32302.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 59..247 | 17..207 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:48:37 Download gff for
BO32302.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 45..233 | 17..207 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:48:37 Download gff for
BO32302.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17140630..17140821 | 17..207 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:18 Download gff for
BO32302.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13028135..13028326 | 17..207 | 98 | | Minus |
BO32302.pep Sequence
Translation from 16 to 223
> BO32302.pep
MNSSKNDVRSSFKYGPAVRIGIAVLVLHTVGWLGWKAVNQGAESKEAAAK
AQQEQLRAVFAEKASFLDH
BO32302.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:07:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43107-PA | 63 | CG43107-PA | 1..63 | 1..63 | 317 | 100 | Plus |