Clone BO32302 Report

Search the DGRC for BO32302

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:323
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG43107-RA
Protein status:BO32302.pep: Imported from assembly
Sequenced Size:223

Clone Sequence Records

BO32302.complete Sequence

223 bp assembled on 2012-07-09

GenBank Submission: KX794833

> BO32302.complete
GAAGTTATCAGTCGACATGAACAGTTCCAAAAACGATGTCCGTTCTTCCT
TTAAATACGGGCCAGCTGTCCGGATCGGAATCGCCGTCCTGGTGCTCCAC
ACCGTCGGCTGGCTGGGTTGGAAGGCGGTGAACCAGGGTGCGGAATCCAA
GGAGGCAGCAGCGAAGGCCCAGCAAGAACAATTGCGAGCGGTATTCGCAG
AAAAGGCAAGCTTTCTAGACCAT

BO32302.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-RA 192 CG43107-PA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-RA 371 CG43107-RA 45..233 17..205 945 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17140633..17140821 205..17 945 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:39:26 has no hits.

BO32302.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-09 16:49:15 Download gff for BO32302.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 59..247 17..207 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:18 Download gff for BO32302.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 59..247 17..207 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:48:37 Download gff for BO32302.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 45..233 17..207 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:48:37 Download gff for BO32302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17140630..17140821 17..207 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:18 Download gff for BO32302.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13028135..13028326 17..207 98   Minus

BO32302.pep Sequence

Translation from 16 to 223

> BO32302.pep
MNSSKNDVRSSFKYGPAVRIGIAVLVLHTVGWLGWKAVNQGAESKEAAAK
AQQEQLRAVFAEKASFLDH

BO32302.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-PA 63 CG43107-PA 1..63 1..63 317 100 Plus