Clone BO32405 Report

Search the DGRC for BO32405

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:324
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG8446-RD
Protein status:BO32405.pep: Imported from assembly
Sequenced Size:244

Clone Sequence Records

BO32405.complete Sequence

244 bp assembled on 2012-07-09

GenBank Submission: KX796483

> BO32405.complete
GAAGTTATCAGTCGACATGGTTCGACCAACACTAGTTGCGCTGGCTAAGC
GCGTACCGCTCATACACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCC
CAGACAGCAAACCAGAAGTTGGCCGGTGGACCAGCAATTGAGGACTATGA
GCTGCCGGCACGATTTGCCCGCAAGCCAATTGATCCCGAAGAGGCGGCTT
ACATTAATAATGGGGGTATTCCAAACGCAAGCTTTCTAGACCAT

BO32405.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RA 213 CG44242-PA 1..210 17..226 1035 99.5 Plus
CG44242-RB 243 CG44242-PB 130..240 116..226 540 99.1 Plus
CG44242-RB 243 CG44242-PB 1..102 17..118 510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RA 426 CG44242-RA 88..297 17..226 1035 99.5 Plus
CG44242-RB 456 CG44242-RB 217..327 116..226 540 99.1 Plus
CG44242-RB 456 CG44242-RB 88..189 17..118 510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16196690..16196799 117..226 535 99.1 Plus
2R 25286936 2R 16196471..16196572 17..118 510 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:39:08 has no hits.

BO32405.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-09 16:49:12 Download gff for BO32405.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RD 86..295 17..228 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:11 Download gff for BO32405.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 88..297 17..228 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:48:30 Download gff for BO32405.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 88..297 17..228 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:48:30 Download gff for BO32405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196471..16196572 17..118 100 -> Plus
2R 16196692..16196799 119..228 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:11 Download gff for BO32405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083976..12084077 17..118 100 -> Plus
arm_2R 12084197..12084304 119..228 97   Plus

BO32405.pep Sequence

Translation from 16 to 244

> BO32405.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF
ARKPIDPEEAAYINNGGIPNASFLDH

BO32405.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PA 70 CG44242-PA 1..70 1..70 364 100 Plus
CG44242-PB 80 CG44242-PB 1..80 1..70 343 87.5 Plus