BO32405.complete Sequence
244 bp assembled on 2012-07-09
GenBank Submission: KX796483
> BO32405.complete
GAAGTTATCAGTCGACATGGTTCGACCAACACTAGTTGCGCTGGCTAAGC
GCGTACCGCTCATACACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCC
CAGACAGCAAACCAGAAGTTGGCCGGTGGACCAGCAATTGAGGACTATGA
GCTGCCGGCACGATTTGCCCGCAAGCCAATTGATCCCGAAGAGGCGGCTT
ACATTAATAATGGGGGTATTCCAAACGCAAGCTTTCTAGACCAT
BO32405.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:39:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-RA | 213 | CG44242-PA | 1..210 | 17..226 | 1035 | 99.5 | Plus |
CG44242-RB | 243 | CG44242-PB | 130..240 | 116..226 | 540 | 99.1 | Plus |
CG44242-RB | 243 | CG44242-PB | 1..102 | 17..118 | 510 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:39:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-RA | 426 | CG44242-RA | 88..297 | 17..226 | 1035 | 99.5 | Plus |
CG44242-RB | 456 | CG44242-RB | 217..327 | 116..226 | 540 | 99.1 | Plus |
CG44242-RB | 456 | CG44242-RB | 88..189 | 17..118 | 510 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:39:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16196690..16196799 | 117..226 | 535 | 99.1 | Plus |
2R | 25286936 | 2R | 16196471..16196572 | 17..118 | 510 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:39:08 has no hits.
BO32405.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-09 16:49:12 Download gff for
BO32405.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8446-RD | 86..295 | 17..228 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:11 Download gff for
BO32405.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44242-RA | 88..297 | 17..228 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:48:30 Download gff for
BO32405.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44242-RA | 88..297 | 17..228 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:48:30 Download gff for
BO32405.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16196471..16196572 | 17..118 | 100 | -> | Plus |
2R | 16196692..16196799 | 119..228 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:11 Download gff for
BO32405.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12083976..12084077 | 17..118 | 100 | -> | Plus |
arm_2R | 12084197..12084304 | 119..228 | 97 | | Plus |
BO32405.pep Sequence
Translation from 16 to 244
> BO32405.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF
ARKPIDPEEAAYINNGGIPNASFLDH
BO32405.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:07:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-PA | 70 | CG44242-PA | 1..70 | 1..70 | 364 | 100 | Plus |
CG44242-PB | 80 | CG44242-PB | 1..80 | 1..70 | 343 | 87.5 | Plus |