Clone BO32771 Report

Search the DGRC for BO32771

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:327
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG15461-RA
Protein status:BO32771.pep: Imported from assembly
Sequenced Size:208

Clone Sequence Records

BO32771.complete Sequence

208 bp assembled on 2012-07-12

GenBank Submission: KX795275

> BO32771.complete
GAAGTTATCAGTCGACATGGTGGAGAAAACCAAAACACTTCAGCTGCTGC
TAATGGCTCGCGCCGTATTGACGATCATCTATAATGACCACTTCTGCTGG
ACCTTCATAAAGAGCTATGGACTCTTCTCGCTGGCGATTCCGCTGGCCAA
GTACTTCGATGGCTTCCAAGTGTTGCCCACCGGTGACGTGGCAAGCTTTC
TAGACCAT

BO32771.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-RA 177 CG15461-PA 1..174 17..190 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-RA 332 CG15461-RA 106..279 17..190 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20486362..20486535 17..190 870 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:42:56 has no hits.

BO32771.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-12 11:18:03 Download gff for BO32771.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 106..279 17..192 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:35 Download gff for BO32771.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 106..279 17..192 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:49:55 Download gff for BO32771.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 106..279 17..192 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:49:55 Download gff for BO32771.complete
Subject Subject Range Query Range Percent Splice Strand
X 20486362..20486535 17..192 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:35 Download gff for BO32771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20357389..20357562 17..192 98   Plus

BO32771.pep Sequence

Translation from 16 to 208

> BO32771.pep
MVEKTKTLQLLLMARAVLTIIYNDHFCWTFIKSYGLFSLAIPLAKYFDGF
QVLPTGDVASFLDH

BO32771.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-PA 58 CG15461-PA 1..58 1..58 302 100 Plus