Clone BO32866 Report

Search the DGRC for BO32866

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:328
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG6115-RA
Protein status:BO32866.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO32866.complete Sequence

289 bp assembled on 2012-07-12

GenBank Submission: KX794058

> BO32866.complete
GAAGTTATCAGTCGACATGTCACAGCTGCGCTCGAAAGTCATTAGCCTCT
ACAAGCACTTGCAGTATTTGGGCCGCGAATATCCCGGCCTGAACGGGCCG
CAGAAGTTCAGGAAGCAGATCCACGATGCCTTCATGAACCACAAGGACGA
GCAGGATCCCAAGAAGATCGTCGCCCTGCTAGCCCAAGGACGTTACTTGG
CCAAGGAGGTGGAGGCCCTGTACTCGCTGAAGAAGTACCGAAGTGTCAAG
CAGCGCTATAGTTACAATGACGCAAGCTTTCTAGACCAT

BO32866.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6115-RB 258 CG6115-PB 1..255 17..271 1275 100 Plus
CG6115-RA 258 CG6115-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG6115-RB 743 CG6115-RB 133..387 17..271 1275 100 Plus
CG6115-RA 727 CG6115-RA 133..387 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16887465..16887681 271..55 1070 99.5 Minus
2L 23513712 2L 16887793..16887834 58..17 210 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:43:19 has no hits.

BO32866.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-12 11:18:07 Download gff for BO32866.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 129..383 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:45 Download gff for BO32866.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 133..387 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:02 Download gff for BO32866.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 133..387 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:02 Download gff for BO32866.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16887463..16887677 59..273 99 <- Minus
2L 16887793..16887834 17..58 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:45 Download gff for BO32866.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16887463..16887677 59..273 99 <- Minus
arm_2L 16887793..16887834 17..58 100   Minus

BO32866.pep Sequence

Translation from 16 to 289

> BO32866.pep
MSQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKK
IVALLAQGRYLAKEVEALYSLKKYRSVKQRYSYNDASFLDH

BO32866.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG6115-PB 85 CG6115-PB 1..85 1..85 441 100 Plus
CG6115-PA 85 CG6115-PA 1..85 1..85 441 100 Plus