Clone BO32952 Report

Search the DGRC for BO32952

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:329
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG15715-RA
Protein status:BO32952.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO32952.complete Sequence

265 bp assembled on 2012-07-13

GenBank Submission: KX798653

> BO32952.complete
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAAAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCCAAGACGTATAAACAGCACTTCG
AGAACAAGCATCCCAAGAACGACATACCCGAGGAGCTGAAGGAGGTCGCA
AGCTTTCTAGACCAT

BO32952.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-RB 234 CG15715-PB 1..231 17..247 1155 100 Plus
CG15715-RA 234 CG15715-PA 1..231 17..247 1155 100 Plus
CG18081-RC 234 CG18081-PC 1..231 17..247 1020 96.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-RB 969 CG15715-RB 270..500 17..247 1155 100 Plus
CG15715-RA 735 CG15715-RA 233..463 17..247 1155 100 Plus
CG18081-RC 717 CG18081-RC 198..428 17..247 1020 96.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15836780..15836923 160..17 720 100 Minus
3L 28110227 3L 15834734..15834877 160..17 705 99.3 Minus
3L 28110227 3L 15836162..15836250 247..159 445 100 Minus
3L 28110227 3L 15834365..15834453 247..159 325 91 Minus
Blast to na_te.dros performed on 2014-11-28 11:43:53 has no hits.

BO32952.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-13 13:50:20 Download gff for BO32952.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 231..461 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:59 Download gff for BO32952.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 233..463 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:11 Download gff for BO32952.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 233..463 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:11 Download gff for BO32952.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15836159..15836248 161..249 97 <- Minus
3L 15836780..15836923 17..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:59 Download gff for BO32952.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15829259..15829348 161..249 97 <- Minus
arm_3L 15829880..15830023 17..160 100   Minus

BO32952.pep Sequence

Translation from 16 to 265

> BO32952.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDIPEELKEVASFLDH

BO32952.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-PB 77 CG15715-PB 1..77 1..77 404 100 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 404 100 Plus
CG18081-PC 77 CG18081-PC 1..77 1..77 398 97.4 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 398 97.4 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 398 97.4 Plus